DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGB4

DIOPT Version :10

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_660206.2 Gene:HMGB4 / 127540 HGNCID:24954 Length:186 Species:Homo sapiens


Alignment Length:87 Identity:19/87 - (21%)
Similarity:41/87 - (47%) Gaps:8/87 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHP 244
            :||.::|:::.:....::..:||.....:::|..|..|...::.||.|:......|||.:.:|..
Human    94 RRPPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELE 158

  Fly   245 DYKYRPRRKTKTLTKTKEKYPM 266
            .|:.:        ...::||.|
Human   159 LYRKQ--------CNARKKYRM 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 HMG-box_SoxB 177..252 CDD:438790 16/71 (23%)
HMGB4NP_660206.2 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..98 2/3 (67%)
HMG-box_HMGB_rpt2 91..161 CDD:438795 15/66 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.