DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and SOX30

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_848511.1 Gene:SOX30 / 11063 HGNCID:30635 Length:753 Species:Homo sapiens


Alignment Length:549 Identity:125/549 - (22%)
Similarity:178/549 - (32%) Gaps:186/549 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LHSSSE--LSPTQSSIGSHHMTSPVSHQQHTQ------QQQHGQQQHL---------GAGSALSS 154
            :|.|:|  |:||..:.|.|.....:....||.      |.|......|         ...:.:.|
Human   236 VHGSAEVILAPTSGAFGPHQQDLRIPLTLHTVPPGARIQFQGAPPSELIRLTKVPLTPVPTKMQS 300

  Fly   155 LTGGSSNNNNNSATANKNQQHA---------DR---VKRPMNAFMVWSRGQRRKMASDNPKMHNS 207
            |...|................|         ||   |||||||||||:|..|..:|..||..:|:
Human   301 LLEPSVKIETKDVPLTVLPSDAGIPDTPFSKDRNGHVKRPMNAFMVWARIHRPALAKANPAANNA 365

  Fly   208 EISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPR---RK-------------TKT 256
            |||.:||.:|..|||.:|:|:.|||::::..|.:|.|.:.|:||   ||             |:.
Human   366 EISVQLGLEWNKLSEEQKKPYYDEAQKIKEKHREEFPGWVYQPRPGKRKRFPLSVSNVFSGTTQN 430

  Fly   257 LTKTKE----------------------KYPMGGLMPG------------------QTVGGGA-- 279
            :..|..                      .:|:|...|.                  .:|...|  
Human   431 IISTNPTTVYPYRSPTYSVVIPSLQNPITHPVGETSPAIQLPTPAVQSPSPVTLFQPSVSSAAQV 495

  Fly   280 ----PGEPVTP------------------------TRVQGQPGQNQSLNGSGGSAAAAAAAAAAA 316
                |..||.|                        |..|..|...:|.|....||:.|.|..|.:
Human   496 AVQDPSLPVYPALPPQRFTGPSQTDTHQLHSEATHTVKQPTPVSLESANRISSSASTAHARFATS 560

  Fly   317 AQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVS 381
            ..|..:: |...:|            .|..|...|.|.:...:..|...:||.        .|:.
Human   561 TIQPPRE-YSSVSP------------CPRSAPIPQASPIPHPHVYQPPPLGHP--------ATLF 604

  Fly   382 GGQTSPYGSSLQQP-GSPSP-YGGSSLQQQPGSPTPYGGGGGGGGQVSCQSHSPSDSSIKSEPVS 444
            |   :|...|...| ..|.| |..||  ..|.|..|:|.|........|.|:. .|...|.|.:.
Human   605 G---TPPRFSFHHPYFLPGPHYFPSS--TCPYSRPPFGYGNFPSSMPECLSYY-EDRYPKHEGIF 663

  Fly   445 PSPSAIALNNNNNINNNHIMKREYSSAAAAAAAAAAAAAAGG----------GELN--------- 490
                       :.:|.::.. |:|||....:..:.:.....|          ||.|         
Human   664 -----------STLNRDYSF-RDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDI 716

  Fly   491 -HLMNMYHLPDEQRHLLHYQTDSPDLQQQ 518
             .|.|::..|          |.:|...||
Human   717 GTLENVFTAP----------TSTPSSIQQ 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 35/73 (48%)
SOX30NP_848511.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..161
SOX-TCF_HMG-box 336..406 CDD:238684 34/69 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 514..575 13/73 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 726..753 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.