DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox8a

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001271361.1 Gene:sox8a / 102216265 ZFINID:ZDB-GENE-130530-719 Length:401 Species:Danio rerio


Alignment Length:280 Identity:96/280 - (34%)
Similarity:133/280 - (47%) Gaps:64/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KNQQHADRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRL 235
            |::.|   |||||||||||::..|||:|...|.:||:|:||.||..|:.|||||||||::||:||
Zfish    81 KDKPH---VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERL 142

  Fly   236 RAVHMKEHPDYKYRPRRK--------------TKTLTKTKEKYPM-GGL--MPGQTVGG----GA 279
            |..|.|::|||||:|||:              .|.|..|...|.. .|:  |..||:.|    |.
Zfish   143 RLQHKKDYPDYKYQPRRRKSLKPGQNEAEAGAEKNLHHTDPIYKTEAGMRAMHHQTIHGVQPHGP 207

  Fly   280 PGEPVTPTRVQGQ------PGQNQSLNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMP-NG 337
            |..|.||...|.|      ....|:::.|....:..::....:..|     :.:...:.|:| ||
Zfish   208 PTPPTTPKSDQHQSMKRLSENARQNIDFSNVDISELSSDVIGSISQ-----FDVREFDQYLPLNG 267

  Fly   338 YMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPG------ 396
               |.:..|         |||.:...:.....:::|.:.:...||   ||..||..|..      
Zfish   268 ---HTESGG---------GQHSSPGCFSTSFHHHSGASAWNKPSG---SPSTSSANQQRPLIKTE 317

  Fly   397 --SPSPYGGSSLQQQPGSPT 414
              |||.||     |..||||
Zfish   318 QLSPSHYG-----QSHGSPT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 44/70 (63%)
sox8aNP_001271361.1 Sox_N <40..73 CDD:372113
SOX-TCF_HMG-box 85..155 CDD:238684 44/72 (61%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.