DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox8

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_002932315.2 Gene:sox8 / 100497725 XenbaseID:XB-GENE-480865 Length:466 Species:Xenopus tropicalis


Alignment Length:457 Identity:119/457 - (26%)
Similarity:170/457 - (37%) Gaps:151/457 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LHSSSE--------LSPTQSSIGSHHMTSPVSHQQHTQQQQHGQQQHLGAG-SALSSLTGGSSNN 162
            |:.|||        .|||.::....|::...|....:.....|:..|...| |.||...|..:.:
 Frog     2 LNMSSEQEHVPEPPCSPTGTASSMSHVSDSDSDSPLSPAGSEGRGSHRPPGISQLSKRDGEETMD 66

  Fly   163 NNNSATAN-------------------------KNQQHADRVKRPMNAFMVWSRGQRRKMASDNP 202
            ....|...                         |.:.|   |||||||||||::..|||:|...|
 Frog    67 ERFPACIREAVSQVLKGYDWSLVPMPVRGSGGLKAKPH---VKRPMNAFMVWAQAARRKLADQYP 128

  Fly   203 KMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMG 267
            .:||:|:||.||..|:.|||:|||||::||:|||..|.|:||||||:|||: |:....:.....|
 Frog   129 HLHNAELSKTLGKLWRLLSENEKRPFVEEAERLRVQHKKDHPDYKYQPRRR-KSAKAGQSDSDSG 192

  Fly   268 ---GLMPGQTV-----GGGAPGE--------------PVTPT--RVQGQPGQNQSLNGSGGSAAA 308
               ||..|..:     |.|:.||              |..||  :.....|..|.|...|     
 Frog   193 AELGLHGGSQMYKSDSGMGSMGENHLHSEHAGQNHGPPTPPTTPKTDLHHGGKQELKHEG----- 252

  Fly   309 AAAAAAAAAQQARQDM--------------------YQMNAPNGYMP-NGY----MMHADPAGAA 348
                 ....:..||::                    :.::..:.|:| ||:    ..|...|.||
 Frog   253 -----RRMMESGRQNIDFSNVDISELSSEVINNIEAFDVHEFDQYLPLNGHGPIPADHGQNATAA 312

  Fly   349 AYQTSYMGQHYAAQRYDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSPSPYGGSSLQQQPGSP 413
            .|.:||                        |.:.|.|:....|.:.|.:.|.....|.||:|   
 Frog   313 PYASSY------------------------THAPGATAAPVWSHKSPSTSSSSSSESGQQRP--- 350

  Fly   414 TPYGGGGGGGGQVSCQSHSPSDSSIKSEPVSPSPSAIALNNNNNINNNHIMKREYSSAAAAAAAA 478
                                   .||:|.:|||    ..|:.:..:..|.....||:.|.|....
 Frog   351 -----------------------HIKTEQLSPS----HYNDQSQGSPTHSDYNTYSAQACATTVP 388

  Fly   479 AA 480
            :|
 Frog   389 SA 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 44/70 (63%)
sox8XP_002932315.2 Sox_N <39..94 CDD:372113 8/54 (15%)
SOX-TCF_HMG-box 104..174 CDD:238684 44/72 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.