DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and HMGXB4

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:XP_006724164.1 Gene:HMGXB4 / 10042 HGNCID:5003 Length:603 Species:Homo sapiens


Alignment Length:281 Identity:59/281 - (20%)
Similarity:109/281 - (38%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QSHLTHSQLSHHNHHHHHMS----------AHIAASQSPN-PLSSLQ-------SSMANTLNGSQ 91
            ||.|..::..|.:....|.|          :..|.|.|.| .||.|:       ||....|...:
Human   285 QSFLKTARKKHKSSSDAHSSPGPEGCGSDASQFAESHSANLDLSGLEPILVESDSSSGGELEAGE 349

  Fly    92 V-----------GQQQQQQQQQQSSPLHSSSELSPTQSSIGSHHMTSPVSHQQHTQQQQHGQQQH 145
            :           .::.::.::::....|.....|.::.|:|...:  ||.....|.    |....
Human   350 LVIDDSYREIKKKKKSKKSKKKKDKEKHKEKRHSKSKRSLGLSAV--PVGEVTVTS----GPPPS 408

  Fly   146 LG-AGSALSSL------TGGSSNNNNNSATANKNQQHADRVKRP-MNAFMVWSRGQRRKMASDNP 202
            :. ||:|...|      |.|.|.........:|.::..::.|:. |:|:.|:.:..|..:.:|:|
Human   409 IPYAGAAAPPLPLPGLHTDGHSEKKKKKEEKDKERERGEKPKKKNMSAYQVFCKEYRVTIVADHP 473

  Fly   203 KMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLTKTKEKYPMG 267
            .:...|:||:|...||.|.|.:|..:..:|:.|           :::..:...|..|.|.....|
Human   474 GIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYL-----------QHKQNKAEATTVKRKASSSEG 527

  Fly   268 GL-MPGQTVGGGAPGEPVTPT 287
            .: :...:||..:|.:...||
Human   528 SMKVKASSVGVLSPQKKSPPT 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 18/71 (25%)
HMGXB4XP_006724164.1 DUF4171 150..268 CDD:290491
HMG-box 450..513 CDD:238037 18/73 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.