DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox18

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001123409.1 Gene:sox18 / 100170185 XenbaseID:XB-GENE-483233 Length:362 Species:Xenopus tropicalis


Alignment Length:253 Identity:81/253 - (32%)
Similarity:118/253 - (46%) Gaps:49/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 RVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKE 242
            |::|||||||||::.:|:::|..||.:||:.:||.||..||:||.:|||||::||:|||..|:::
 Frog    67 RIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGQSWKNLSSAEKRPFVEEAERLRVQHLQD 131

  Fly   243 HPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQS--------- 298
            ||:|||||||| |...|.|..                  :|....|.:|..||..:         
 Frog   132 HPNYKYRPRRK-KQAKKLKRV------------------DPSPLLRNEGYRGQAMANLSHFRDLH 177

  Fly   299 -LNGSGGSAAAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSY-MGQHYAA 361
             |.|||.    ..:......:.:..|:.:.:.| .:.|......|||.....||... .||....
 Frog   178 PLGGSGD----LESYGLPTPEMSPLDVVEPSEP-AFFPPHMREEADPGPFRTYQHGVDFGQEKTL 237

  Fly   362 QR----YDMGHMYNNGYAMYQTVSGGQTSPYGSSLQQPGSP--SPYGGSSLQQQPGSP 413
            :.    |.....:..|:....|.|....:|:|      |||  :|.|  .|...|.:|
 Frog   238 REISLPYSSSPSHMGGFLRTPTASAFYYNPHG------GSPACTPLG--QLSPPPEAP 287

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 39/70 (56%)