DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SoxN and sox14

DIOPT Version :9

Sequence 1:NP_001260269.1 Gene:SoxN / 44275 FlyBaseID:FBgn0029123 Length:761 Species:Drosophila melanogaster
Sequence 2:NP_001093703.1 Gene:sox14 / 100101715 XenbaseID:XB-GENE-485370 Length:239 Species:Xenopus tropicalis


Alignment Length:309 Identity:116/309 - (37%)
Similarity:149/309 - (48%) Gaps:86/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 DRVKRPMNAFMVWSRGQRRKMASDNPKMHNSEISKRLGAQWKDLSESEKRPFIDEAKRLRAVHMK 241
            |.:|||||||||||||||||||.:|||||||||||||||:||.|||:||||:|||||||||.|||
 Frog     6 DHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMK 70

  Fly   242 EHPDYKYRPRRKTKTLTKTKEKYPMGGLMPGQTVGGGAPGEPVTPTRVQGQPGQNQSLNGSGGSA 306
            ||||||||||||.|.|.| |::|    :.|...:|...|.:.                    |.:
 Frog    71 EHPDYKYRPRRKPKNLLK-KDRY----VFPLPYLGDHDPLKT--------------------GLS 110

  Fly   307 AAAAAAAAAAAQQARQDMYQMNAPNGYMPNGYMMHADPAGAAAYQTSYMGQHYAAQRYDMGHMYN 371
            .:|..:...|:::||..:...:||...:        ||:..::.....|        .:|.|   
 Frog   111 MSATDSLLGASEKARAFLPPTSAPYSLL--------DPSQFSSTTIQKM--------TEMPH--- 156

  Fly   372 NGYAMYQTVSGGQTSPYGSSL-QQPGSPSPYGGSSLQQQ-----PGSPTPYGGGGGGGGQVSCQS 430
                    .....|.||.|:| .|.|:   :||.|...|     |....|       |..|.|..
 Frog   157 --------TLAASTLPYASTLGYQNGA---FGGLSCPSQHTHTHPSPTNP-------GYVVPCNC 203

  Fly   431 HSPSDSSIKSEPVS----PSPSAIALNNNNNINNNHIMKREYSSAAAAA 475
            .:.|.|::: .||:    |..:...|:             .||||..||
 Frog   204 SAWSASNLQ-PPVAYILFPGMTKAGLD-------------PYSSAHTAA 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SoxNNP_001260269.1 SOX-TCF_HMG-box 178..249 CDD:238684 61/70 (87%)
sox14NP_001093703.1 SOX-TCF_HMG-box 7..78 CDD:238684 61/70 (87%)
SOXp 77..>95 CDD:372055 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.