DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment xmas and CG3437

DIOPT Version :9

Sequence 1:NP_001356948.1 Gene:xmas / 44271 FlyBaseID:FBgn0286809 Length:2079 Species:Drosophila melanogaster
Sequence 2:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster


Alignment Length:360 Identity:92/360 - (25%)
Similarity:156/360 - (43%) Gaps:43/360 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 QGHCADMCPEKERVLREFQRQVAYYELQPGSDE----LICHERALKQYSRSSADQETPLPHELRN 259
            :|.|...||:.|..:|..::.:.|:||:.|...    |:      |:::||:||.:.|:|.|:|.
  Fly     5 RGSCESFCPDGEAKMRIREKLLHYFELKNGQKNKPGVLV------KEFTRSAADVKMPMPKEMRT 63

  Fly   260 ETALHMTMSYLMHEIMDISERQDPQSHMGDWFHFVWDRTRSIRKEITQQELCSLGAVKLVEQCAR 324
            |.||..|:.||:.:|  |.:.:.|.:...|   |::||.|::|:||..|...:...:.|:|....
  Fly    64 EAALTKTVEYLLKDI--ILDTRKPYNVAYD---FIFDRLRAVRREIVIQMYDASQKICLLEPIVM 123

  Fly   325 FHIHCAARLVDADPSVFDSKINAENLTKCLQTLKYMY---HDLRIKGVPCPKEAEFRGYI----V 382
            |..:...||.:.....||.||..::|.:||..:...|   .||.....|..:|.|.|.:|    .
  Fly   124 FLAYSRYRLCEEPIEKFDLKICNQHLQECLTGVLCCYEELEDLESSREPTVRELERRCFIESLYQ 188

  Fly   383 LLNLADANFLWDIGQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYF 447
            |.||...........||..::.....:......||.|..|..|.  |:......::...:..   
  Fly   189 LFNLGSPESFTRALTLPDYVRRDATFKLCFGICLAFQQGNLYRV--LMGVPQLPHILCAVAA--- 248

  Fly   448 TRLRVLGLHRLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGL---------QINE 503
            .:|:|: ...|:|.:.....::..::|:.|:..||.|.......|..:||.:         |.|:
  Fly   249 AKLQVI-RRSLLQIFTHAYNNKQLTVPVPYLLRLLLFDGPTGLQDQCRHYNISLTADRKAVQFNK 312

  Fly   504 A----GRVVLSRMHTVETEYKLPRQY--ELVEVKR 532
            .    ...|.:..|....|.||.|.|  |::.:|:
  Fly   313 TDFNHNAEVFTPQHERFVESKLKRIYIPEVLLLKK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
xmasNP_001356948.1 RRM_XMAS2 12..82 CDD:240903
SAC3_GANP 200..503 CDD:335312 82/322 (25%)
DUF5401 <638..>827 CDD:340095
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 61/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12436
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1280
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.