DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut2 and CG17929

DIOPT Version :9

Sequence 1:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_650532.2 Gene:CG17929 / 41978 FlyBaseID:FBgn0038415 Length:491 Species:Drosophila melanogaster


Alignment Length:438 Identity:93/438 - (21%)
Similarity:158/438 - (36%) Gaps:128/438 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GWTPLLMLICLTVTLGTT----IPVGYFFGVLNAPAEIIKKWCQDILANEYDTIVTAGQLDILWT 74
            ||..         ||.||    ....:|.|||...|          ||:          |.:.:.
  Fly    74 GWNQ---------TLNTTATQVFKCSWFIGVLAGAA----------LAS----------LTMTFL 109

  Fly    75 SIVSIYLIGGICGSCFSAVLCDKYGRKGCLV-----------ISSVLFVV-SGILFTWCRAAKSL 127
            ..:..|::||:.....|.:...|....|||:           :.:|.|:: |..:.|......|.
  Fly   110 PKLPFYVLGGLMQLTGSIIFTCKPFDYGCLLAARYVAGAGIGLITVPFLIHSAEVATDNHRGVSG 174

  Fly   128 EMLMTGRFLGGIASALIFTAQPMYLLESAPSELSGSVG-VFTCIGVTGGILLAQVATLSHLLGSE 191
            .|...|..| |||..:|:..|.:...|::.:|:.|.:| ||:.||                    
  Fly   175 SMEQCGLAL-GIAIQVIYDTQWVDDKEASVNEVHGIIGIVFSIIG-------------------- 218

  Fly   192 RLWPYALSFYSLLVMASLVLLWWFPESPRWLYLHKRDSAASEKALLRLRGRNTEEEVHQELLEMK 256
                        |.|.:|.:     |||.: ||..:....:.|...:|.| :....|.||..|::
  Fly   219 ------------LGMTALSI-----ESPIY-YLRIKQKEKARKCHAKLLG-SFNHSVDQEFEEIQ 264

  Fly   257 ATLEAKSSSEVSSLCSVLRNSEL-WLPLLLVCSFQATQQLSGINAIFFYSL----SILTNAGFSD 316
            ..:   :.|:..:.|..||.|.: ::.|||...|.|          |.:||    |::.:|..::
  Fly   265 LYV---AESQKRTFCQELRISVVPFIKLLLYRGFVA----------FSFSLPLSESLIKSALLTE 316

  Fly   317 G-AATWLNLGIGSFNLCTSLLGPLLIRRFPRRPLMMISCSMCALALLAMSLGLFFLERSESTVLT 380
            | .:.|.....|...|..:|:....:.:..|:.:.::.....|:.:|.|:..   .....:.::|
  Fly   317 GFISCWPVTVWGLVRLLGALVAQGFLDKLGRKFVSLVGLLCMAILMLCMAAS---YANPANALMT 378

  Fly   381 YFC----------AAFILTFILGFQLGLGP----------IAYFIGSE 408
            |:.          .||...|:....:.||.          :.|.||.|
  Fly   379 YYMYQVWRLGLAFQAFAGLFVCSSSVYLGEAFPIKVKPFFVGYIIGFE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 91/429 (21%)
MFS 76..466 CDD:119392 79/372 (21%)
CG17929NP_650532.2 Sugar_tr 67..482 CDD:278511 93/438 (21%)
MFS 295..>425 CDD:119392 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444616
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.