DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut2 and CG8837

DIOPT Version :9

Sequence 1:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster


Alignment Length:509 Identity:131/509 - (25%)
Similarity:209/509 - (41%) Gaps:91/509 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPKVNGWTPLLMLICLTVTLGTTI--PVGYFFGVLNAPAEIIKKWCQDILANEYDTIVTAGQLDI 71
            |.:|.|  |.:..:  ...||..:  ..|..||:..|...:.:...:..|....|...||     
  Fly     4 PKRVGG--PAIQSV--ATALGNILCFNFGLMFGITPAHMTLYESEERTPLNQATDPAGTA----- 59

  Fly    72 LWTSIVSIYLIGGICGSCFSAVLCDKYGRKGCLVISSVLFVVSGILFTWC--RAAKSLEMLMTGR 134
             |  :.....:....|:..|..|..|.|.|..|:.|.:| .:||    |.  .....:..:...|
  Fly    60 -W--LTGYLFLSAALGALVSGFLALKIGPKSVLLCSGLL-QISG----WACIHFGYDIVHIYASR 116

  Fly   135 FLGGIASALIFTAQPMYLLESAPS-----ELSGSVGVFTCIGVTGGILLAQVATLSHLLGSERLW 194
            ...|:||...|...|:::.|.|.|     .|:.::.::..:|:..|.:|....            
  Fly   117 LFAGVASGAAFVVLPIFINEIAESREKAARLTFTIELWRTLGILIGFVLGFYV------------ 169

  Fly   195 PYALSFYSLLVMA-SLVLLWWFP---ESPRWLYLHKRDSAASEKALLRLRG-RNTEE----EVHQ 250
            |||  |.:::..| |.|....||   |||.: ||.|.:.|:.||:|...|| |:.::    |...
  Fly   170 PYA--FVNIVGCAVSFVFTMTFPFVQESPHY-YLRKNNMASLEKSLRWYRGIRDIDDREKPEYLS 231

  Fly   251 ELLEMKATLEAKSSSEVSSLCS---VLRNSELWLPLLLVCSFQATQQLSGINAIFFYSLSILTNA 312
            ||.|..|.|.::..:..|:..|   ::|.:.:.. ||.||:     :|||:.....|:...|...
  Fly   232 ELNEFHAELRSRDKNVGSTPMSHGYIIRLTFVSF-LLTVCA-----KLSGVFVELNYAADFLGRT 290

  Fly   313 GFSDGAATWLN-LGIGSFNLCTSLLGPLLIRRFPRRPLMMISCSMCALALLAMSLGLFFLERSES 376
            |:|    |..| :.:.|.....:||..|:..|.||:.|:.:|....|.|::|::|   |......
  Fly   291 GYS----TETNYVVLASAQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIALAL---FKAYGHL 348

  Fly   377 TVLTYFCAAFILTFILGFQL-----GLGPIAYFIGSELLEDSPRPVAMSMGSLFSWIGNFLVGMC 436
            .:|..:...::...:|..||     ||.|:|..:.||:|......:..|:.|..||:  .|.||.
  Fly   349 WLLGNWADRYLPIILLAIQLALVSFGLYPLAAVVSSEVLPTKLHDLLYSLASAVSWL--LLFGMI 411

  Fly   437 FP-----------LLQSVWSSFAFIPCMCVCIYCLLLTWRYLPETRGREPKDVK 479
            ..           ||..:| .||     ...|:..|::...|||||.|.|..|:
  Fly   412 EAFNAVKATIAPGLLLYLW-VFA-----GASIFVGLISLPLLPETRNRRPSAVQ 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 124/487 (25%)
MFS 76..466 CDD:119392 108/425 (25%)
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 38/164 (23%)
Sugar_tr 58..453 CDD:278511 116/443 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444386
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.