DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut2 and Slc2a6

DIOPT Version :9

Sequence 1:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:307 Identity:83/307 - (27%)
Similarity:137/307 - (44%) Gaps:50/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 VMASLVLLWWFPESPRWLYLHKRDSAASEKALLRLRGRNTEEEVHQELLEMKATLEAKSSSEVSS 269
            |:..::||.:.|.|||:|....||..|.: ||:.||   .:.|||.|..:::..:. :.||.||.
  Rat    21 VLVMILLLSFMPNSPRFLLSKSRDEEALQ-ALIWLR---ADSEVHWEFEQIQDNVR-RQSSRVSW 80

  Fly   270 LCSVLRNSELW-----LPLLLVCSFQATQQLSGINAIFFYSLSILTNAGF-----SDGAATWLNL 324
                   :|.|     .|:|:....:..|||:||..|..|..:|..:...     .|.|.     
  Rat    81 -------AEAWEPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPSQQDAAI----- 133

  Fly   325 GIGSFNLCTSLLGPLLIRRFPRRPLMMISCSMCALALLAMSLGLFFLERS---ESTV-------- 378
             :|:..|.:.|:..:.:....|:.|:.:|.|:..:|.|.:.|.:..:.|:   .|||        
  Rat   134 -VGAVRLLSVLIAAVTMDLAGRKVLLYVSASIMFVANLTLGLYVQLVPRTLTPNSTVEIVTLGGT 197

  Fly   379 ----------LTYFCAAFILTFILGFQLGLGPIAYFIGSELLEDSPRPVAMSMGSLFSWIGNFLV 433
                      ||.......:.||:|:.:|.|||.:.:.||:|....|.||..:..|.||:..|::
  Rat   198 EQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVL 262

  Fly   434 GMCFPLLQSVWS-SFAFIPCMCVCIYCLLLTWRYLPETRGREPKDVK 479
            ...|.|..:.:. ...|.....:|:..||.|...:||||||..:.::
  Rat   263 TKYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQIE 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 81/299 (27%)
MFS 76..466 CDD:119392 77/292 (26%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 51/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.