DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut2 and Slc2a6

DIOPT Version :9

Sequence 1:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_766247.2 Gene:Slc2a6 / 227659 MGIID:2443286 Length:497 Species:Mus musculus


Alignment Length:424 Identity:119/424 - (28%)
Similarity:192/424 - (45%) Gaps:45/424 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SIYLIGGICGSCFSAVLCDKYGRKGCLVISSVLFVVSGILFTWCRAAKSLEMLMTGRFLGGIASA 142
            |::.:|...|...:.:|.|..|||..::.|:   |.|.|.:.....|:.|.||:.||.|.|.|..
Mouse    85 SVFTLGAAAGGLSAMLLNDLLGRKLSIMFSA---VPSAIGYAIMAGARGLWMLLLGRMLTGFAGG 146

  Fly   143 LIFTAQPMYLLESAPSELSGSVGVFTCIGVTGGILLAQVATLS-HLLGSERLWPYALSFYSLLVM 206
            |.....|:|:.|.||.::.|::|...       .|:|...:|| :.||....|.:........|:
Mouse   147 LTAACIPVYVSEIAPPDVRGALGATP-------QLMAVFGSLSLYALGLLLPWRWLAVAGEGPVL 204

  Fly   207 ASLVLLWWFPESPRWLYLHKRDSAASEKALLRLRGRNTEEEVHQELLEMKATLEAKSSSEVSSLC 271
            ..::||.:.|.|||:|....||    |:||..|.....:.|||.|..:::..:. :.||.||  .
Mouse   205 IMILLLSFMPNSPRFLLSKSRD----EEALQALTWLRADSEVHWEFEQIQDNVR-RQSSRVS--W 262

  Fly   272 SVLRNSELWLPLLLVCSFQATQQLSGINAIFFYSLSILTNAGF-----SDGAATWLNLGIGSFNL 331
            :..|...::.|:|:....:..|||:||..|..|..:|..|...     .|.|.      :|:..|
Mouse   263 AEAREPRVYRPVLIAVLMRFLQQLTGITPILVYLQTIFDNTSVVLPSQQDAAI------VGAVRL 321

  Fly   332 CTSLLGPLLIRRFPRRPLMMISCSMCALALLAMSLGLFFLER---SESTV------------LTY 381
            .:.|:..:.:....|:.|:.:|.|:...|.|.:.|.:.|:.|   ..|||            ||.
Mouse   322 LSVLIAAVTMDLAGRKVLLYVSASVMFAANLTLGLYVQFVPRPLTPNSTVEIVTLGDTAFNYLTL 386

  Fly   382 FCAAFILTFILGFQLGLGPIAYFIGSELLEDSPRPVAMSMGSLFSWIGNFLVGMCFPLLQSVWS- 445
            ......:.||:|:.:|.|||.:.:.||:|....|.||..:..|.||:..|::...|.|..:.:. 
Mouse   387 IPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVLTNYFLLAVNAFGL 451

  Fly   446 SFAFIPCMCVCIYCLLLTWRYLPETRGREPKDVK 479
            ...|.....:|:..||.|...:||||||..:.::
Mouse   452 QVPFFFFSAICLLSLLFTGCCVPETRGRSLEQIE 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 117/416 (28%)
MFS 76..466 CDD:119392 113/409 (28%)
Slc2a6NP_766247.2 Dileucine internalization motif. /evidence=ECO:0000255 5..6
MFS 38..483 CDD:391944 119/420 (28%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 284..290 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.