DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut2 and K09C4.2

DIOPT Version :9

Sequence 1:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:97 Identity:31/97 - (31%)
Similarity:48/97 - (49%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 GLGPIAYFIGSELLEDSPRPVAMSMGSLFSWIGNFLVGM----CFPLLQSVWSSFAFIPCMCVCI 457
            |...|.....:||...|.|.| :....||   |:..|||    .||::.|::|...|:|.:.|..
 Worm    13 GANAIRLLFVTELFPPSARTV-VGQAMLF---GSMAVGMPVVSLFPIINSIFSPIFFVPFVIVQT 73

  Fly   458 YCLLLTWRYLPETRGREPKDVKLLMSQGLSSK 489
            ...:..:||:||||||...|:...|.:.::|:
 Worm    74 VFGIYLYRYMPETRGRAVYDIIESMDKDVASR 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 26/79 (33%)
MFS 76..466 CDD:119392 20/72 (28%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 26/79 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158139
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0569
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.