DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut3 and CG32053

DIOPT Version :9

Sequence 1:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_729587.1 Gene:CG32053 / 39178 FlyBaseID:FBgn0052053 Length:496 Species:Drosophila melanogaster


Alignment Length:460 Identity:101/460 - (21%)
Similarity:175/460 - (38%) Gaps:91/460 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YSSRLGDSQMTIIMSTVVSIFLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFCRMA 117
            :.|.|.:.::|   :.|...:.||.::||.....||.....:.::....|:.:...|.....|| 
  Fly    79 FDSSLSELEVT---NHVQICWFIGAIIGALLGGFFSRWFPYKTLMEFCSLITITGGIVMAVNRM- 139

  Fly   118 NSIEMLLLGRLIGGLAAALIYATQPMYLVELAPA-ELSGSVGVF--------------TCIGLTG 167
             .::.||.||.:.|||..|          .:||. .::|.:.||              |.||:..
  Fly   140 -DLDALLAGRYMNGLANGL----------AIAPTLAMAGELSVFYKRGTTTSAAEQWPTTIGIFV 193

  Fly   168 GIVLGQVFSF--DFLLGTEKLWPYALSGSAIFVLIGLAPIFWF---PESPRFLMSQGRREKARVT 227
            .||....:..  ||   ||:.:...|||    ||..:|.:..|   .|||..|:.||..:.|...
  Fly   194 QIVCSHSWDVQSDF---TEEQFQGVLSG----VLGSIALLLAFLLSIESPVDLLEQGNEQGAVQA 251

  Fly   228 LMRLRRDEGRVNAEMAEFEVSSTDEGQVTMKQVLCNSKLKLPLFIVCSFHFVQQMSGISAIWFYS 292
            |.||:|.    .|..||......|.............:..||..:        ::|.:.|:  |:
  Fly   252 LSRLQRP----RAVTAETYDQVRDHRTYVEHHRSMGWRHALPALV--------RLSVLRAL--YA 302

  Fly   293 IEIFTQSGFTAAVAMWLN-----------FALGLLNFISALMGPWLMRSFNRRLMMTISCLCSAI 346
            :.:.....||.|   |.:           ...|.|..:.:....:.:.|..|::.:.:..:.|. 
  Fly   303 LSLSVMVAFTLA---WTSTEVYGDSSGPYVLFGFLRLMGSFTTSFALDSLGRKIPLLLGLVISG- 363

  Fly   347 FLVLLVVGL-ELMSTIHEFSFT----CIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMAL 406
               .|..|| ...:..|..:|:    .:..|.:|.:...:...|:..:: ||.|....:...:|:
  Fly   364 ---CLACGLASRFAGSHPLTFSGNRMALWLLLIYQLFAGIAFAPSSSYL-SEAFPRRIKRPCIAI 424

  Fly   407 GSFFNWLANFVL-NMIFPTL---NSATGPFVFLLCVVFCAYGFLLTYRYLPETRNRDAKDVAQLM 467
            ......:...:| .|.|..:   :|....:.|:|..:..| |||.:..|:|||::      ..|:
  Fly   425 TYILEIIVQLLLRQMDFAAIGSDSSYVALYFFILGGLLLA-GFLFSVWYMPETKD------TTLL 482

  Fly   468 ENGFK 472
            :..||
  Fly   483 QAQFK 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 98/452 (22%)
MFS 66..451 CDD:119392 91/424 (21%)
CG32053NP_729587.1 MFS 73..428 CDD:119392 84/392 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444541
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.