DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut3 and CG14160

DIOPT Version :9

Sequence 1:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:456 Identity:93/456 - (20%)
Similarity:179/456 - (39%) Gaps:127/456 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFCRMANSIEMLLLGRLIGGLAAALI 137
            :.||..:||..|.:|..|:.:....|.||.|::::.|..:.      :....|......::....
  Fly    68 WFIGAAVGALLAALFVQRVTKNVAYTSSGFLMIIAGILNVV------LPQHFLAACYSSVSVGAA 126

  Fly   138 YA-TQPMYLV---ELAPAELSGSV----GVFTCIGLTGGIVLGQVF------------SFDFLLG 182
            |. ||...||   |:|...:.|.:    .:|..:|     |..|||            :..:.:.
  Fly   127 YGLTQIQALVTGSEVAHKSIRGMLLSCEKIFLWLG-----VCMQVFYTRVWHNLRPLDTQGYEMH 186

  Fly   183 TEKLWPYALSGSAI-FVLIGLAPIFWFPESPRFLMSQGR-----------REKARVTLMRLRRDE 235
            .::|....|:|..: .|::.||...   |||..|:.|.|           ..::...|:|||.|.
  Fly   187 IDQLHGMVLAGLGLGAVILALAHRL---ESPLLLLHQERDMAVGETLKALHGQSTTELVRLREDC 248

  Fly   236 GRVNA-----EMAEFEVSSTDEGQVTMKQVL---------CNSKLKLPL-----FIVCSFHFVQQ 281
            .::::     ...|....|..:.:|..:::|         |.:.|.:.|     |:|.|:|.:: 
  Fly   249 RQLHSARDWERFVEEPEESVADWRVWARRILPFFKVLLLRCFATLAVSLSYNRAFVVVSWHGLE- 312

  Fly   282 MSGISAIWFYSIEIFTQSGFTAAVAMWLNFALGLLNFISALMGPWLMRSFNRRLMMTISCLCSAI 346
             ..::.::                  ||.|| ||   |.:::|.:::....||.:.::|...:.:
  Fly   313 -CDMNCMY------------------WLAFA-GL---IGSVLGAFVVDWQGRRKVCSLSLFLAGV 354

  Fly   347 FLVLLVVG-----LE-LMSTIHEFSFTCIAFLSLYIITFNMGLGPTPYFI-GSEIFETASRPSAM 404
              |:::||     || :..:.::.:...||.|.|.......|....|..: .:|.|..|.:...:
  Fly   355 --VIVMVGGVFDHLESVKRSFYDINLLVIALLMLLFEVIVAGGVAVPALVYTAEAFSIAHKARCL 417

  Fly   405 A--------------LGSFFNWLANFVLNMIFPTLNSATGPFVFLLCVVFCAYGFLLTYRYLPET 455
            |              |.:|.:::   .:::.|.|:    |.|.|::        .|..:.::|||
  Fly   418 AGILIVEQLLQLGLLLATFEHYI---TVSVFFFTI----GVFSFIV--------GLTVFMFMPET 467

  Fly   456 R 456
            |
  Fly   468 R 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 93/456 (20%)
MFS 66..451 CDD:119392 89/449 (20%)
CG14160NP_648380.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.