DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut3 and CG8249

DIOPT Version :9

Sequence 1:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001246349.1 Gene:CG8249 / 36742 FlyBaseID:FBgn0034045 Length:521 Species:Drosophila melanogaster


Alignment Length:443 Identity:106/443 - (23%)
Similarity:192/443 - (43%) Gaps:47/443 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LGDSQMTIIMSTVVSIFLIGGMLGAPFAPIFSARLGRRGILTLSGLLLLVSCICQLFCRMANSIE 121
            |.|||.:...|.......|||:|..    ....|:||:..|.:..:|::::.|  |....:.|.:
  Fly    82 LNDSQASWFASVNALSAPIGGLLSG----FLLDRIGRKKSLIVLNVLIILAWI--LLATPSESDQ 140

  Fly   122 -----MLLLGRLIGGLAAALIYATQPMYLVELAPAELSGSVGVFTCIGLTGGIV----LGQVFSF 177
                 .|::.|.:.|:...|..|...:|..|::..:..||:.:.|.|.:.|||.    :|.....
  Fly   141 NAFFWQLIVSRFMLGVGMGLASAPPGVYAAEISVPKTRGSLILGTSISVAGGITILYGIGYCIRD 205

  Fly   178 DFLLGTEKLWPYALSGSAIFVLIGLAPIFWFPESPRFLMSQGRREKARVTLMRLR----RDEGRV 238
            ||     :|......|..:..|:.:.|:   |||..:|:|:.|..:|:.:|...|    .||...
  Fly   206 DF-----RLIALICCGYQLVALLCVLPL---PESHCWLLSKKRVTEAKRSLNYFRGFNKSDEITH 262

  Fly   239 NAEMAEFEV--SSTDEGQVTMKQV----LCNSKLKLPLFIVCSFHFVQQMSGISAIWFYSIEIFT 297
            ...:.||::  .|..:....:|:.    |...::..||.|:.|....||::||..:..::::|..
  Fly   263 PQVLEEFQLLQKSLQQRNTAVKESFWRNLHEPEVYKPLVILMSLFAFQQLTGIFVVIVFAVQISQ 327

  Fly   298 QSG-----FTAAVAMWLNFALGLLNFISALMGPWLMRSFNRRLMMTISCLCSAIFLVLLVVGLEL 357
            ::|     |..||      .:||...|:.....:::..:.||....||.|..::.:.|| .|...
  Fly   328 EAGIEIDPFMCAV------LIGLARLITTCPMGYILEWWGRRRAGIISTLGMSVCMFLL-AGHSQ 385

  Fly   358 MSTIHEFSFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMALGSFFNWLANFVLNMIF 422
            :..:.|..:..:..:..:|:...:||...|:|:.||:|....|..|..|........:||:...:
  Fly   386 IEILKEVPYLPVVAIVGFIVLSTLGLYTLPFFMISELFPQKVRGPASGLTVAVGMFISFVVLKTY 450

  Fly   423 PTLNSATG-PFVFLLCVVFCAYGFLLTYRYLPETRNRDAKDVAQLMENGFKSK 474
            |.:....| ...|::..|...:..:..|..|||||.|...::.:...:| :||
  Fly   451 PGIKEYLGMSNCFIIFGVMALFALIFVYLALPETRRRTLLEIEEQFRSG-RSK 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 103/433 (24%)
MFS 66..451 CDD:119392 93/409 (23%)
CG8249NP_001246349.1 MFS 49..479 CDD:119392 96/417 (23%)
Sugar_tr 60..496 CDD:278511 103/434 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.