DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut3 and Slc2a13

DIOPT Version :9

Sequence 1:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_598295.2 Gene:Slc2a13 / 171147 RGDID:621814 Length:637 Species:Rattus norvegicus


Alignment Length:545 Identity:132/545 - (24%)
Similarity:207/545 - (37%) Gaps:132/545 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GYAFGVMNAPSAFIRSWIMESVLERYSSRLGDSQMTIIMSTVVSIFLIGGMLGAPFAPIFSARLG 92
            ||..||::.          ..:|.|...|||.....:::|..|....:..:.|.    ..:..||
  Rat    85 GYDTGVVSG----------AMLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGG----ALNGALG 135

  Fly    93 RRGILTLSGLLLLVSCIC----QLFCRMANSIEMLLLGRLIGGLAAALIYATQPMYLVELAPAEL 153
            ||      ..:||.|.:|    .:....||. |.||.|||:.||...:...|.|:|:.|::|..|
  Rat   136 RR------SAILLASALCTVGSAVLAAAANK-ETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNL 193

  Fly   154 SGSVGVFTCIGLTGGIVLGQVFSFDFLLGTEKLWPYALSGSAIFVLIGLAPIFWFPESPRFLMSQ 218
            .|.:.....:.:|||.....|....|....:..|.|.|..:||..:|......:.|||||:|:.:
  Rat   194 RGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQK 258

  Fly   219 GRREKARVTLMRLR--------RDEGRVNAEMAEFEVSSTDEGQVTMKQVLCNSKLKLP-----L 270
            |:.:|||..|.::|        .|..|.:.|..|.|.|:..       .::|. .|..|     |
  Rat   259 GQTQKARRILSQMRGNQTIDEEYDSIRNSIEEEEKEASAAG-------PIICR-MLSYPPTRRAL 315

  Fly   271 FIVCSFHFVQQMSGISAIWFYSIEIFTQSGF-TAAVAMWLNFALGLLNFISALMGPWLMRSFNRR 334
            .:.|.....||:|||:.|.:||..|...||. ...:|:||.......|||..|:|.||:....||
  Rat   316 AVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRR 380

  Fly   335 LMMTISCLCSAIFLVLLVVGLELMSTIH------------------------------------- 362
            .:...|...:.:.|.:|.:|..|.:.:.                                     
  Rat   381 KLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTAPSGQNATCTEYSYCNECMLDPDCGFCYK 445

  Fly   363 -----------------------------------------------EFSFTCIAFLSLYIITFN 380
                                                           .:|:|.:..|.||::.|.
  Rat   446 INSSAVIDSSCVPVNKASTNEAAWGRCENETKFKAEDVHWAYSFCPTPYSWTALVGLVLYLVFFA 510

  Fly   381 MGLGPTPYFIGSEIFETASRPSAMALGSFFNWLANFVLNMIF-PTLNSATGPFVFLLCVVFCAYG 444
            .|:||.|:.:.|||:...:|.:..|..:..||:.|.::::.| .|....|....|.|...|.|.|
  Rat   511 PGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVG 575

  Fly   445 FLLTYRYLPETRNRDAKDVAQLMEN 469
            .|..|..||||:.:..:::..|.::
  Rat   576 LLFVYGCLPETKGKKLEEIESLFDH 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 131/540 (24%)
MFS 66..451 CDD:119392 118/487 (24%)
Slc2a13NP_598295.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..38
MFS 75..580 CDD:119392 126/523 (24%)
Sugar_tr 78..598 CDD:278511 131/541 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.