DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sut3 and LOC103910009

DIOPT Version :9

Sequence 1:NP_524731.1 Gene:sut3 / 44268 FlyBaseID:FBgn0028561 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_009296669.1 Gene:LOC103910009 / 103910009 -ID:- Length:148 Species:Danio rerio


Alignment Length:106 Identity:33/106 - (31%)
Similarity:57/106 - (53%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 SFTCIAFLSLYIITFNMGLGPTPYFIGSEIFETASRPSAMALGSFFNWLANFVLNMIFPTLNSAT 429
            |..|:..:   |..|.:|....|:.:..|:|:.:.||||..:|...||::||.:..:||.|..:.
Zfish     5 SVACVVGI---IAGFCIGPAGVPFLMTGELFKQSHRPSAYIVGGSLNWISNFAVGFVFPFLQMSA 66

  Fly   430 GPFVFL----LCVVFCAYGFLLTYRYLPETRNRDAKDVAQL 466
            |.|.:|    :||...||.|.:    :|||:|:...::::|
Zfish    67 GAFCYLVFCGVCVGVAAYVFFI----IPETKNKTFLEISEL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sut3NP_524731.1 Sugar_tr 28..466 CDD:278511 32/104 (31%)
MFS 66..451 CDD:119392 28/89 (31%)
LOC103910009XP_009296669.1 Sugar_tr <1..104 CDD:278511 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D291809at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.