DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and ogre

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001245557.1 Gene:ogre / 45382 FlyBaseID:FBgn0004646 Length:362 Species:Drosophila melanogaster


Alignment Length:331 Identity:146/331 - (44%)
Similarity:221/331 - (66%) Gaps:4/331 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVINTFCWITYTYTIPGQQHRQ 90
            ||.|||.|...||.:|.||.:|:||...:|.|||||.:| :|.||:||||||..|:|:|....||
  Fly    20 DNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNG-VPPHVVNTFCWIHSTFTMPDAFRRQ 83

  Fly    91 IGTDVAGPGLGNEYGQE--KRYHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLRGM 153
            :|.:||.||:.|::|.|  |:|::|||||.||||||.:..|.|.::|...|.|.:|||..||...
  Fly    84 VGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNIT 148

  Fly   154 VSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTD 218
            :...:: :..::|.:|.|.:..:..|..|:..|:.||.|..||:||.::::::|..|.|:||||:
  Fly   149 ICTREE-KEAKRDALLDYLIKHVKRHKLYAIRYWACEFLCCINIIVQMYLMNRFFDGEFLSYGTN 212

  Fly   219 VLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFII 283
            ::|.|::.|::|.|||:.:|||:|||||||:|||||:||||:||:|.|||:|||.|:|:||||.|
  Fly   213 IMKLSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWI 277

  Fly   284 LATISGVAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLVRRLEIGDFLILHFLSQNLSTRSY 348
            |..:....:::...:|.||..|..::..|.|....:....|.|:|:|||:.:::.|.:||....|
  Fly   278 LLVLLIGLIVFRGCIIFMPKFRPRLLNASNRMIPMEICRSLSRKLDIGDWWLIYMLGRNLDPVIY 342

  Fly   349 SDMLQQ 354
            .|::.:
  Fly   343 KDVMSE 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 146/331 (44%)
ogreNP_001245557.1 Innexin 20..351 CDD:279248 146/331 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.