DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and Inx2

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001162684.1 Gene:Inx2 / 31646 FlyBaseID:FBgn0027108 Length:367 Species:Drosophila melanogaster


Alignment Length:355 Identity:164/355 - (46%)
Similarity:240/355 - (67%) Gaps:8/355 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFGMVSAVSGFIKIRYLLDKAVIDNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP 67
            :|.:..:|.|.:||    |:..|||.|||.||:.|..||....::||:...|||||.||.| .||
  Fly     1 MFDVFGSVKGLLKI----DQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVD-EIP 60

  Fly    68 MHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGN--EYGQEKRYHSYYQWVPFVLFFQGLMFYV 130
            :.|::|:|||..|:|:|.:.....|.||..||:|:  |...|.:||.|||||.||||||.::|||
  Fly    61 LGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYV 125

  Fly   131 PHWVWKNMEDGKIRMITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHNGYSFAYFFCELLNFI 195
            |.::||:.|.|:::|:...|...: |.|:.:.||:..::.||:.:||.||.|:|.:|.||.|||:
  Fly   126 PRYLWKSWEGGRLKMLVMDLNSPI-VNDECKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFV 189

  Fly   196 NVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDT 260
            |||..|:.||.||.|.|.:||:|||||:.::.|:|.|||..:||::|||||||:|||||||.||.
  Fly   190 NVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDG 254

  Fly   261 LCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLV 325
            ||||.|||:|||||:|||||||||:.:||::::|.:.|:..|..|..:::...|.|:.:|:..:.
  Fly   255 LCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLLLRARSRLAESEEVELVA 319

  Fly   326 RRLEIGDFLILHFLSQNLSTRSYSDMLQQL 355
            .:..|||:.:|:.|.:|:....|.:::..|
  Fly   320 NKCNIGDWFLLYQLGKNIDPLIYKEVISDL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 157/332 (47%)
Inx2NP_001162684.1 Innexin 1..351 CDD:295599 164/355 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.