DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and Inx6

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_572374.1 Gene:Inx6 / 31645 FlyBaseID:FBgn0027107 Length:481 Species:Drosophila melanogaster


Alignment Length:399 Identity:110/399 - (27%)
Similarity:184/399 - (46%) Gaps:44/399 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFGMVSAVSGFIKIRYLLDKAVIDNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP 67
            ::..|..:|.:::::.:.    |.:.:|..|.:.|..||.||..:::|....|:||.|::... .
  Fly     1 MYAAVKPLSNYLRLKTVR----IYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSER-Q 60

  Fly    68 MHVINTFCWITYTYTIPGQQHRQIGTD------------------------VA-----------G 97
            ...:.::||...||.:|.:..|..|:.                        ||           .
  Fly    61 ADYVQSYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYARFISIA 125

  Fly    98 PGLGNE-YGQEKR-YHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLRGMVSVPDDY 160
            .|:|.| .|..|| |..|||||..:|.||.|:||.|.::||..|..::..:...:...:.|...|
  Fly   126 EGVGPETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEVGDALIVEATY 190

  Fly   161 RRDRQDRILKYF-VNSLNTHNGYSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSN 224
             |.|...:.:|| ......|..||..|.||||||....|:|.:::|....|.:..|...:.....
  Fly   191 -RTRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNGFWYKYIHALAAIPV 254

  Fly   225 MDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISG 289
            .|.:........:||::.||....:||||:....|.||||.||||||||:..|:.||:.:|.::.
  Fly   255 YDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILNEKIFAVLYVWFLFIALLAI 319

  Fly   290 VAVLYSLVVIMMPTTRETIIKRSYRSAQRKEIAGLVRRLEIGDFLILHFLSQNLSTRSYSDMLQQ 354
            :.:||.|:||..|..|..:::.......:..:..::.....||:.:|..:|.|::...:.::|:|
  Fly   320 MNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGYGDWFVLMCVSINVNPTLFRELLEQ 384

  Fly   355 LCGLLGASR 363
            |...|..:|
  Fly   385 LYAKLNQAR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 104/367 (28%)
Inx6NP_572374.1 Innexin 21..389 CDD:279248 105/369 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 1 1.000 - - FOG0003274
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
98.970

Return to query results.
Submit another query.