DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and inx-20

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001251235.1 Gene:inx-20 / 188818 WormBaseID:WBGene00002142 Length:483 Species:Caenorhabditis elegans


Alignment Length:347 Identity:81/347 - (23%)
Similarity:136/347 - (39%) Gaps:79/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIPMHVINT-------FCWITYTYTI 83
            |::..|.||..||..|....::::.....|.||.|    .:|....::       :||...||. 
 Worm    45 DDIFDRLHYYYTTTFLLLTAVLISLKMFGGRPIEC----WLPAEYKSSWEDYTEMYCWARNTYV- 104

  Fly    84 PGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNMED-------- 140
                     |......|.....:|....||||||||.|.:....||.|..:|:...|        
 Worm   105 ---------TAFEDDNLPEVVNREYTMVSYYQWVPFFLVYVAFSFYAPCLIWRLFYDKSGIRLKD 160

  Fly   141 ------GKIRMI----TDGLRGMVSVPDDYRRDR---------QDRILKYFVNSLNTHNGY-SFA 185
                  .|..::    |..:||:.:......:.|         ..::.:.|  ::..:..| ::.
 Worm   161 IMGFANDKANVVPTQRTANIRGLSAHLSSVFKHRFRIGEKHPYHHKVFRIF--NVRYYESYLTYL 223

  Fly   186 YFFCELLNFINVIVNIFMVDKFL---GGAFMSYGT--DVLKFSNMDQDKRFDPMIEIFPRLTKCT 245
            |...:.|..:||:..::.:.:||   ...:..||.  |::......:...       ||.:|.|.
 Worm   224 YLAIKCLFLMNVLTQMYFMSRFLELDSHRYYGYGIFYDLIMGKGWKESSN-------FPVVTYCD 281

  Fly   246 FHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMMPTTRETIIK 310
            . :....|.||:|...|||.:||..|||:..||.|:.:|:.||..::| |.:...:|..      
 Worm   282 M-QIRILGHVQRHTVQCVLVINIFTEKIFFILWLWYTMLSLISFGSIL-SWIFASIPFN------ 338

  Fly   311 RSYRSAQRKEIAGLVRRLEIGD 332
                  ||::.  :.||||:.|
 Worm   339 ------QRRQF--IARRLELAD 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 81/347 (23%)
inx-20NP_001251235.1 Innexin 45..403 CDD:279248 81/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.