DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and unc-7

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001337312.1 Gene:unc-7 / 181608 WormBaseID:WBGene00006747 Length:546 Species:Caenorhabditis elegans


Alignment Length:339 Identity:93/339 - (27%)
Similarity:154/339 - (45%) Gaps:81/339 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISC-----INDGAIPMHVINTFCWITYTYTIPG 85
            |:.|.:.:|..||.||.:..::|:|...:|.||.|     ..| |:..:..| :||:..||.:|.
 Worm   163 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTD-AMEQYTEN-YCWVQNTYWVPM 225

  Fly    86 QQH--RQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNM---EDGKIRM 145
            |:.  |:|            |.:..|...|||||||:|..:.|:||||..:|:.:   ..|    
 Worm   226 QEDIPREI------------YSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSG---- 274

  Fly   146 ITDGLRGMVSVPDDYRR--------------------------DRQDRILKYFVN-----SLNTH 179
              ..|:|:|.:..|.|.                          |||......|.|     :...|
 Worm   275 --INLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRH 337

  Fly   180 NG--YSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPM--IE---- 236
            .|  .:..|...::|...||::..|:::..||...::||..:||          |.|  ||    
 Worm   338 CGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLK----------DLMHAIEWEQT 392

  Fly   237 -IFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIM 300
             :|||:|.|.| :....|::.:|...|||.:|:.||||::||||||:....::....:|.::::.
 Worm   393 GMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMF 456

  Fly   301 MPTTRETIIKRSYR 314
            :|:...:.:::..|
 Worm   457 IPSQGMSFVRKYLR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 93/339 (27%)
unc-7NP_001337312.1 Innexin 163..525 CDD:307154 93/339 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 1 0.900 - - OOG6_104894
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.