DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and inx-6

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_502435.1 Gene:inx-6 / 178231 WormBaseID:WBGene00002128 Length:389 Species:Caenorhabditis elegans


Alignment Length:343 Identity:89/343 - (25%)
Similarity:151/343 - (44%) Gaps:50/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MVSAVSGFIKIRYLLDKAVID---NMVFRCHYRITTAILFTCCIIVTANNLIGDPISC---INDG 64
            |.|.|.....:..|:.:..:.   ::..|.:.|:|..||.....::.:::.|||||:|   ....
 Worm     1 MASQVGAINSVNALISRVFVQPKGDLADRLNSRVTVVILAVSSALLLSSHFIGDPITCWTPAQFN 65

  Fly    65 AIPMHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYH---SYYQWVPFVLFFQGL 126
            |..::.:|.:|::..||.:|..|  |:.           :.:|:|..   .||||||:|...|..
 Worm    66 AQWVNFVNQYCFVHGTYFVPLDQ--QLA-----------FEEEERTKVSIQYYQWVPYVFALQAF 117

  Fly   127 MFYVPHWVWKNMEDGKIRMITDGLRGMVSVPDDY---RRDRQDRI---LKYFVN--SLNTHNGYS 183
            :||:|.::||.|    |......|...|...|.:   .||:.|:.   |..|..  |:...:|..
 Worm   118 LFYIPRFIWKAM----IAYSGYDLAAAVKYVDRFWSENRDKDDKFKTRLAAFEGRPSVYIWDGIR 178

  Fly   184 FA-----------YFFCELLNFINVIVNIFMVDKFLGGA-FMSYGTDVLKFSNMDQDKRFDPMIE 236
            .|           |....:...:|..:..:::.:.|..: :..:|..:|  .::.|...:.....
 Worm   179 LARKKRSRNMALFYTLSTVWQAVNAWIQFYILTQLLDSSIYTLWGPSIL--GDLLQGNDWQTTGH 241

  Fly   237 IFPRLTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIMM 301
             |||:..|.|::..|: |||....||||.|||..||::||||||.:.:|.:|.|.....:..:..
 Worm   242 -FPRIVHCDFNRRRPA-SVQLDTVLCVLTLNIYYEKLFIFLWFWLVFVAVVSTVNCFKWIYYLCN 304

  Fly   302 PTTRETIIKRSYRSAQRK 319
            .|..:..||....:|..|
 Worm   305 KTKAQKTIKNYLSTAPIK 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 85/323 (26%)
inx-6NP_502435.1 Innexin 25..364 CDD:395704 85/319 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.