DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and inx-16

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_491314.1 Gene:inx-16 / 172005 WormBaseID:WBGene00002138 Length:372 Species:Caenorhabditis elegans


Alignment Length:288 Identity:77/288 - (26%)
Similarity:127/288 - (44%) Gaps:43/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DNMVFRCHYRITTAILFTCCIIVTANNLIGDPISCINDGAIP---MHVINTFCWITYTYTIPGQQ 87
            |..:.|.:|.:||:||....:::.|.|.:|:|:.|.......   .....::|:|..||.:|.| 
 Worm    22 DTSIDRLNYVVTTSILIAFSLLLFAKNYVGEPMQCWTPNQFAGGWESFAESYCFIENTYFVPMQ- 85

  Fly    88 HRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWKNMEDGKIRMITDGLRG 152
                  |...|......|:|.   .|||||||:|..|.|.|.||...|         :|.....|
 Worm    86 ------DSNLPAAETREGREM---IYYQWVPFLLVIQALFFCVPRAFW---------IIYPSYSG 132

  Fly   153 MVSVPDDYRRDRQD--------------RILKYFVNSLNTHNGYSF-AYFFCELLNFINVIVNIF 202
            : ::.|.....||:              .::.:.......|....| .|...:||..:|:::..|
 Worm   133 L-TIADMITAARQNGKQLEGADEALEQVAMINWRTEQQKGHGSRIFNCYLVMKLLILLNIVLQFF 196

  Fly   203 MVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGSVQKHDTLCVLALN 267
            :::.||..|:..:|..:  |.:|...:.:..... |||::.|..: ....|::......|||.:|
 Worm   197 LLNSFLNTAYTFWGWGI--FWDMVNGRHWQESGH-FPRVSFCDIN-VRELGNIHHWSLQCVLMVN 257

  Fly   268 ILNEKIYIFLWFWF-IILATISGVAVLY 294
            :.||||:||||||| .:|...:|..|::
 Worm   258 MFNEKIFIFLWFWFAFLLVATAGDFVIW 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 77/288 (27%)
inx-16NP_491314.1 Innexin 22..353 CDD:279248 77/288 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.