DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx3 and inx-12

DIOPT Version :9

Sequence 1:NP_001263050.1 Gene:Inx3 / 44266 FlyBaseID:FBgn0265274 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_491213.1 Gene:inx-12 / 171944 WormBaseID:WBGene00002134 Length:408 Species:Caenorhabditis elegans


Alignment Length:300 Identity:74/300 - (24%)
Similarity:131/300 - (43%) Gaps:44/300 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NMVFRCHYRITTAILFTCCIIVTANNLIGDPISC----INDGAIPMHVINTFCWITYTYTIPGQQ 87
            :.|.:.:|..||..|......:|..:.:|.||.|    ...|....:.:: :|::..|:.:|..:
 Worm    18 DFVDKLNYCATTIGLVLASAFITGWSFVGSPIDCWFPAYYKGWWAEYALD-YCYVQNTFFVPFSE 81

  Fly    88 HR--------QIGTD---VAGPGLGNEYGQEKRYHSYYQWVPFVLFFQGLMFYVPHWVWK---NM 138
            .:        |:..|   .......|:.|       |||||||:|..|.::||.|..:|:   .|
 Worm    82 DKAERSYNWEQLVADKQNTTSLKQTNQIG-------YYQWVPFILALQAMLFYFPVVIWRLFYGM 139

  Fly   139 EDGKIRMI------TDG----LRGMVSVPDDYRRDRQDR--ILKYFVNSLNTHNGYSF--AYFFC 189
            ....:..:      |:|    .:|.::....|...::.|  |:|......|..||.:.  :|.|.
 Worm   140 AGQNVTSLCNTCTATEGNEESRKGTITTIAGYISQKRHRNLIVKQLSGFQNRANGSAVITSYLFM 204

  Fly   190 ELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPRLTKCTFHKFGPSGS 254
            :.|..|||:....::.:.||.....:|.:|.  |::.....: |....|||:|.|.: :.....:
 Worm   205 KALFLINVLFQFVLLKRMLGVDSYFWGAEVT--SDLWSGNEW-PETGNFPRVTMCEY-EVRNLDN 265

  Fly   255 VQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLY 294
            :.||...|||.:|:.||||::.||:|...|..::....:|
 Worm   266 IHKHSVQCVLMINMFNEKIFVALWWWLCFLTVVTITNTIY 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx3NP_001263050.1 Innexin 26..356 CDD:279248 73/299 (24%)
inx-12NP_491213.1 Innexin 18..377 CDD:279248 73/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28980
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.