powered by:
Protein Alignment Sara and PLEKHF2
DIOPT Version :9
Sequence 1: | NP_524729.2 |
Gene: | Sara / 44263 |
FlyBaseID: | FBgn0026369 |
Length: | 1343 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_078889.1 |
Gene: | PLEKHF2 / 79666 |
HGNCID: | 20757 |
Length: | 249 |
Species: | Homo sapiens |
Alignment Length: | 75 |
Identity: | 35/75 - (46%) |
Similarity: | 45/75 - (60%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 522 GKVP-----PIWVPDNMAGQCMQCQQ-KFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESR 580
||.| .:||||:.|..||:||: |||.:.||||||.||.|:|..|..:||.|...:....|
Human 138 GKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVR 202
Fly 581 VCVQCYMILS 590
:|..||.:||
Human 203 ICDFCYDLLS 212
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R2928 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.