DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sara and PLEKHF2

DIOPT Version :9

Sequence 1:NP_524729.2 Gene:Sara / 44263 FlyBaseID:FBgn0026369 Length:1343 Species:Drosophila melanogaster
Sequence 2:NP_078889.1 Gene:PLEKHF2 / 79666 HGNCID:20757 Length:249 Species:Homo sapiens


Alignment Length:75 Identity:35/75 - (46%)
Similarity:45/75 - (60%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 GKVP-----PIWVPDNMAGQCMQCQQ-KFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESR 580
            ||.|     .:||||:.|..||:||: |||.:.||||||.||.|:|..|..:||.|...:....|
Human   138 GKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGFVVCGPCSEKRFLLPSQSSKPVR 202

  Fly   581 VCVQCYMILS 590
            :|..||.:||
Human   203 ICDFCYDLLS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SaraNP_524729.2 FYVE_endofin 522..589 CDD:277268 33/72 (46%)
SARA 614..650 CDD:288292
DUF3480 959..1321 CDD:288806
PLEKHF2NP_078889.1 PH_Phafin2-like 7..129 CDD:269927
FYVE_PKHF2 148..211 CDD:277294 30/62 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..249
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.