DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sara and plekhf2

DIOPT Version :9

Sequence 1:NP_524729.2 Gene:Sara / 44263 FlyBaseID:FBgn0026369 Length:1343 Species:Drosophila melanogaster
Sequence 2:NP_956538.1 Gene:plekhf2 / 393214 ZFINID:ZDB-GENE-040426-884 Length:247 Species:Danio rerio


Alignment Length:209 Identity:63/209 - (30%)
Similarity:92/209 - (44%) Gaps:37/209 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 SLSGRKLDGE---VEVDREHEDAS---LATDAL-----ETQEQRPQRPQTLNLNGCQAESST-PS 471
            ::.||.|.||   .::.|:...|.   |..|.|     ..|:::..:...:.|     ||.| .:
Zfish    30 AIPGRVLIGEGVLTKLCRKRPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPL-----ESVTIDT 89

  Fly   472 QDENPEIQQETLQPTEVREGAAGVGVIPGEDDEESPIYEAVGYSDPHANLGKVP-----PIWVPD 531
            .::..|::...|..|..:..|........:.:..|.|.:.|  ||.....||.|     .:||||
Zfish    90 VEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMSHINKCV--SDLLEKSGKSPTGEHAAVWVPD 152

  Fly   532 NMAGQCMQCQQ-KFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCYMILSERQAN 595
            :.|..||:||: |||.:.||||||.||.|:|..|..::|.|...:....|||..||..||     
Zfish   153 SEATVCMRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLS----- 212

  Fly   596 GLNSESAPGSALPP 609
                   .|:.|||
Zfish   213 -------TGATLPP 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SaraNP_524729.2 FYVE_endofin 522..589 CDD:277268 33/72 (46%)
SARA 614..650 CDD:288292
DUF3480 959..1321 CDD:288806
plekhf2NP_956538.1 PH_Phafin2-like 7..129 CDD:269927 21/103 (20%)
PH 39..131 CDD:278594 18/98 (18%)
FYVE_PKHF2 148..211 CDD:277294 30/62 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..247 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.