DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sara and SPBC36B7.05c

DIOPT Version :9

Sequence 1:NP_524729.2 Gene:Sara / 44263 FlyBaseID:FBgn0026369 Length:1343 Species:Drosophila melanogaster
Sequence 2:NP_595987.1 Gene:SPBC36B7.05c / 2540987 PomBaseID:SPBC36B7.05c Length:279 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:37/127 - (29%)
Similarity:50/127 - (39%) Gaps:42/127 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   502 DDEESPIYEAVGYSDPHANLGKVP-PIWVPDNMAGQCMQCQQKFTMIKRRHHCRACGKVLCSVCC 565
            |::|:...||:     ...|.:.| .||..|:.:.||..|...||..:||||||.|||:.|..||
pombe     2 DEDETTYPEAL-----RRLLIETPAAIWQLDDESAQCNNCGGPFTWFRRRHHCRWCGKLFCYNCC 61

  Fly   566 SQRFRLE-----------------FATEPE-------------------SRVCVQCYMILSE 591
            :...:|.                 |..:|:                   .||||.|...|||
pombe    62 NSFAKLPVSSVSVDPTEDLIPQDMFIRDPDFLANDNDDDNDSQDSSWINVRVCVNCRQQLSE 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SaraNP_524729.2 FYVE_endofin 522..589 CDD:277268 29/103 (28%)
SARA 614..650 CDD:288292
DUF3480 959..1321 CDD:288806
SPBC36B7.05cNP_595987.1 FYVE 22..>76 CDD:279674 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2928
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.