DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF5B and eEF1alpha1

DIOPT Version :9

Sequence 1:NP_001246599.1 Gene:eIF5B / 44261 FlyBaseID:FBgn0026259 Length:1144 Species:Drosophila melanogaster
Sequence 2:NP_001286321.1 Gene:eEF1alpha1 / 36271 FlyBaseID:FBgn0284245 Length:463 Species:Drosophila melanogaster


Alignment Length:353 Identity:78/353 - (22%)
Similarity:128/353 - (36%) Gaps:101/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 VCVLGHVDTGKTKI----------LDKLRRTHVQDSEAGGITQQIGATNVPIEAIKEQTKYVK-- 610
            :.|:||||:||:..          :|| |.....:.||    |::|..:.....:.::.|..:  
  Fly    10 IVVIGHVDSGKSTTTGHLIYKCGGIDK-RTIEKFEKEA----QEMGKGSFKYAWVLDKLKAERER 69

  Fly   611 ------AAAGFEHRLPGLLIIDTPGHESFSNLRNRGSSLCDIAILVV-----DIMHGLEP--QTI 662
                  |...||.....:.|||.|||..|......|:|..|.|:|:|     :...|:..  ||.
  Fly    70 GITIDIALWKFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTR 134

  Fly   663 ESIQL---LKKKKCPFIVALNKIDRLYDWKQLARRDVRDVLKEQQSNTQLEFQQRTKDVILQFAE 724
            |...|   |..|:  .||.:||:|                 ..:...::..:::..|:|.....:
  Fly   135 EHALLAFTLGVKQ--LIVGVNKMD-----------------SSEPPYSEARYEEIKKEVSSYIKK 180

  Fly   725 QGLNAALFYENTDPKTYISLVPTSAISGEGM-----------------------GNLLFMIADFC 766
            .|.|.|.          ::.||.|...|:.|                       |..|.   |..
  Fly   181 IGYNPAA----------VAFVPISGWHGDNMLEPSTNMPWFKGWKVERKEGNADGKTLI---DAL 232

  Fly   767 QNMLAKRLMYSEELQATVLEVKALPGLGTTIDAILINGKLREGQTMVVAGTDGPIVTQIRSLLM- 830
            ..:|.......:.|:..:.:|..:.|:||.....:..|.|:.|..:|.|..:  |.|:::|:.| 
  Fly   233 DAILPPARPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGTVVVFAPAN--ITTEVKSVEMH 295

  Fly   831 --------PQPMKELRVKNAYVEYKEVK 850
                    |.......|||  |..||::
  Fly   296 HEALQEAVPGDNVGFNVKN--VSVKELR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF5BNP_001246599.1 PRK04004 553..1129 CDD:235195 78/353 (22%)
IF2_eIF5B 557..769 CDD:206674 56/261 (21%)
aeIF5B_II 779..889 CDD:293904 21/81 (26%)
IF-2 890..993 CDD:288813
IF2_aeIF5B_IV 1016..1110 CDD:293911
eEF1alpha1NP_001286321.1 PTZ00141 1..457 CDD:185474 78/353 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.