DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF1A and EIF1AY

DIOPT Version :9

Sequence 1:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_004672.2 Gene:EIF1AY / 9086 HGNCID:3252 Length:144 Species:Homo sapiens


Alignment Length:148 Identity:114/148 - (77%)
Similarity:126/148 - (85%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65
            ||||||||||||||||||||.|||||:||||.||||||.||||||||||:|||||||||||||||
Human     1 MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKL 65

  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVEDGFDEDI 130
            |||||||..||||||||||||:||||||||..||||:||.|||.||..:||||.|| ..|.|::|
Human    66 RKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTF-GPGDDDEI 129

  Fly   131 EFGDEISSEDDADSVDNI 148
            :| |:|.  ||.:.:|:|
Human   130 QF-DDIG--DDDEDIDDI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 112/145 (77%)
EIF1AYNP_004672.2 PTZ00329 1..131 CDD:185558 107/130 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 23/24 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..144 15/33 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155204
Domainoid 1 1.000 119 1.000 Domainoid score I5810
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100715
Inparanoid 1 1.050 228 1.000 Inparanoid score I3470
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54096
OrthoDB 1 1.010 - - D1426335at2759
OrthoFinder 1 1.000 - - FOG0000631
OrthoInspector 1 1.000 - - otm41457
orthoMCL 1 0.900 - - OOG6_100738
Panther 1 1.100 - - O PTHR21668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R590
SonicParanoid 1 1.000 - - X376
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.