DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF1A and AT2G04520

DIOPT Version :9

Sequence 1:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_178531.1 Gene:AT2G04520 / 814994 AraportID:AT2G04520 Length:145 Species:Arabidopsis thaliana


Alignment Length:149 Identity:103/149 - (69%)
Similarity:115/149 - (77%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65
            ||||||||||||:|||||.:.||||||||||.||||||.:||||||.||||.||.|||||||||:
plant     1 MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKM 65

  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINE-TVTFVEDGFDED 129
            .|||||..|||:|||||||||.||||||||..||||.||.|||.||:.|:|| .|..:||  |:|
plant    66 HKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIVGDLED--DDD 128

  Fly   130 IEFGDEISSEDDADSVDNI 148
            ....|.:..||  :.:|.|
plant   129 NNDDDYVEFED--EDIDRI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 101/146 (69%)
AT2G04520NP_178531.1 PLN00208 1..145 CDD:177798 102/147 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I2157
eggNOG 1 0.900 - - E1_COG0361
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 200 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54096
OrthoDB 1 1.010 - - D1426335at2759
OrthoFinder 1 1.000 - - FOG0000631
OrthoInspector 1 1.000 - - otm3106
orthoMCL 1 0.900 - - OOG6_100738
Panther 1 1.100 - - LDO PTHR21668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X376
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.