DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF1A and eif-1.A

DIOPT Version :9

Sequence 1:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_500650.1 Gene:eif-1.A / 177254 WormBaseID:WBGene00019162 Length:216 Species:Caenorhabditis elegans


Alignment Length:155 Identity:101/155 - (65%)
Similarity:116/155 - (74%) Gaps:13/155 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65
            |||||||||||||||||||:|.||||..||:.|||.||:|||||||::..||||.:|:|||||||
 Worm     1 MPKNKGKGGKNRRRGKNENDFMKRELDLKEEGQEYGQVSKMLGNGRVQVFCFDGKQRVCHIRGKL 65

  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVEDGFDE-D 129
            |||||||.|||||||||||||.|.||||||||||||.||..|..||:.::||     .|..|| :
 Worm    66 RKKVWINVGDIILVGLRDYQDDKGDVILKYTPDEARRLKNEGLIPENAKLNE-----NDEQDEGE 125

  Fly   130 IEFGDEISSE-------DDADSVDN 147
            :||.|.:..|       .|:||.|:
 Worm   126 VEFLDHVGDEGEAGEAKSDSDSSDS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 100/153 (65%)
eif-1.ANP_500650.1 S1_like 1..140 CDD:385635 97/143 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163840
Domainoid 1 1.000 107 1.000 Domainoid score I4077
eggNOG 1 0.900 - - E1_COG0361
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100715
Inparanoid 1 1.050 198 1.000 Inparanoid score I2498
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54096
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000631
OrthoInspector 1 1.000 - - oto17209
orthoMCL 1 0.900 - - OOG6_100738
Panther 1 1.100 - - LDO PTHR21668
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R590
SonicParanoid 1 1.000 - - X376
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.