DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF1A and Eif1ad19

DIOPT Version :9

Sequence 1:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001257651.1 Gene:Eif1ad19 / 100861908 MGIID:5434674 Length:144 Species:Mus musculus


Alignment Length:148 Identity:109/148 - (73%)
Similarity:121/148 - (81%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65
            ||||||||||||.|||||||.|||||:|||..|||||||||||.|||||||||||:|||||||||
Mouse     1 MPKNKGKGGKNRCRGKNENESEKRELVFKEYGQEYAQVTKMLGCGRLEAMCFDGVRRLCHIRGKL 65

  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVEDGFDEDI 130
            |||||||..|||||||:||||:||||||||..||||:||.|||..|..:||||.|| ..|.|::|
Mouse    66 RKKVWINTSDIILVGLQDYQDNKADVILKYNLDEARSLKAYGELQEHAKINETDTF-GPGDDDEI 129

  Fly   131 EFGDEISSEDDADSVDNI 148
            .|.|   :.||.:.:|:|
Mouse   130 VFDD---TGDDDEDIDDI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 107/145 (74%)
Eif1ad19NP_001257651.1 PTZ00329 1..131 CDD:185558 103/130 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845659
Domainoid 1 1.000 119 1.000 Domainoid score I5769
eggNOG 1 0.900 - - E1_COG0361
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3451
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54096
OrthoDB 1 1.010 - - D1426335at2759
OrthoFinder 1 1.000 - - FOG0000631
OrthoInspector 1 1.000 - - otm43508
orthoMCL 1 0.900 - - OOG6_100738
Panther 1 1.100 - - O PTHR21668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X376
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.