DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF1A and Eif1ad5

DIOPT Version :9

Sequence 1:NP_001287386.1 Gene:eIF1A / 44260 FlyBaseID:FBgn0026250 Length:148 Species:Drosophila melanogaster
Sequence 2:XP_036013609.1 Gene:Eif1ad5 / 100039100 MGIID:3780214 Length:144 Species:Mus musculus


Alignment Length:148 Identity:111/148 - (75%)
Similarity:122/148 - (82%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPKNKGKGGKNRRRGKNENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKL 65
            ||||||||||||||||||||.|||||:|||..|||||||||||.|.|||||||||:|||||||||
Mouse     1 MPKNKGKGGKNRRRGKNENESEKRELVFKEYGQEYAQVTKMLGCGWLEAMCFDGVRRLCHIRGKL 65

  Fly    66 RKKVWINQGDIILVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVTFVEDGFDEDI 130
            |||||||..||||:|||||||::||:||||.|||||:||.|||.||..:|||..|| ..|.||:|
Mouse    66 RKKVWINTSDIILIGLRDYQDNRADIILKYNPDEARSLKAYGELPEHAKINEMDTF-GAGDDEEI 129

  Fly   131 EFGDEISSEDDADSVDNI 148
            .|.|  ..|||.| :|:|
Mouse   130 VFDD--IGEDDED-IDDI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF1ANP_001287386.1 PTZ00329 1..147 CDD:185558 109/145 (75%)
Eif1ad5XP_036013609.1 PTZ00329 1..131 CDD:185558 103/130 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1426335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.