DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and HEK2

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_009521.1 Gene:HEK2 / 852248 SGDID:S000000128 Length:381 Species:Saccharomyces cerevisiae


Alignment Length:347 Identity:76/347 - (21%)
Similarity:121/347 - (34%) Gaps:114/347 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 AQTPTATASGNTAAALASAAAAA-------------------------AAATSGGNGSSITNCNS 221
            |.||.|..:.||....:.|.:||                         ||...|..||:|:...:
Yeast     7 AATPVAIPTNNTNGGSSDAGSAATGGAPVVGTTAQPTINHRLLLSLKEAAKIIGTKGSTISRIRA 71

  Fly   222 NNSSSSSNAQQQLQLG-NYKTNSC-----WCYGESV----CSGIEVEIENNNN------------ 264
            .|:         :::| :.|...|     .|.|..:    ..|..|::.|..|            
Yeast    72 ANA---------VKIGISEKVPGCSDRILSCAGNVINVANAIGDIVDVLNKRNPENEDAAEGEAE 127

  Fly   265 --------NHI------------HHGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKM 309
                    |||            ...|...:::::|......:||||.|.||.||....|.::..
Yeast   128 EHYYFHFLNHILPAPSKDEIRDLQQLEDIGYVRLIVANSHISSIIGKAGATIKSLINKHGVKIVA 192

  Fly   310 SKSHDFYPGTTERVCLITG----STEAIMVVMEFIMDKIREK--------PDLTNKIVDTDSKQT 362
            ||  ||.|.:.||:..|.|    .|..::.:.|.|:..:..:        |.|.....:..|..|
Yeast   193 SK--DFLPASDERIIEIQGFPGSITNVLIEISEIILSDVDVRFSTERSYFPHLKKSSGEPTSPST 255

  Fly   363 QERDKQVKILVPNSTAGMIIGKGGAFIKQIK------------------EESGSYVQISQKPTDV 409
            .. :.::::.:|....|.|||:|...||.:|                  |....::..|:.|.:|
Yeast   256 SS-NTRIELKIPELYVGAIIGRGMNRIKNLKTFTKTNIVVERKDDDDKDENFRKFIITSKFPKNV 319

  Fly   410 SLQERCI-----TIIGDKENNK 426
            .|.|..:     |.|..:||.|
Yeast   320 KLAESMLLKNLNTEIEKRENYK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 22/68 (32%)
PCBP_like_KH 368..433 CDD:239089 20/82 (24%)
KH-I 696..759 CDD:238053
HEK2NP_009521.1 KH-I_Rnc1_rpt1 44..113 CDD:411883 14/77 (18%)
KH-I_Rnc1_rpt2 158..226 CDD:411884 22/69 (32%)
KH 257..330 CDD:197652 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103746
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.