DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and AT1G14170

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001117282.1 Gene:AT1G14170 / 837976 AraportID:AT1G14170 Length:479 Species:Arabidopsis thaliana


Alignment Length:405 Identity:83/405 - (20%)
Similarity:146/405 - (36%) Gaps:121/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 GNGSSITNCNSNNSSSSSNAQQQLQ------LGNYKTNSCWCY----GESVCSGIEVEIE----- 260
            |.|..|.....:.:.|:....:.|.      :..|.||....:    ||.||..::...:     
plant    60 GKGGEIAKQIRSETKSNMRINEALPGCEERVVTMYSTNEELNHFGDDGELVCPALDALFKVHDMV 124

  Fly   261 ---------NNNNNHIHHGE-TTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDF 315
                     .:::|.:  || .|..:::|||:...|.:|||||:.|.:|:.||.|::::.|.|  
plant   125 VADADQDDGTDDDNDL--GEKQTVTVRMLVPSDQIGCVIGKGGQVIQNLRNDTNAQIRVIKDH-- 185

  Fly   316 YPG-----TTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQE----------- 364
            .|.     :.:.:.||.|....:...:..:...:.:.|.....::.:.|..:..           
plant   186 LPACALTLSHDELLLIIGEPLVVREALYQVASLLHDNPSRFQHLLLSSSSSSMHQPGAMLMSAAL 250

  Fly   365 ----------------RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQE 413
                            |:..|..:.|....|.:|||||.||.||::|:|:.::::...||   .:
plant   251 TSSHRNYAVRRDIADAREFCVCFICPAENVGGVIGKGGGFINQIRQETGATIRVNTSETD---DD 312

  Fly   414 RCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVAN---------FNPTGSPYAT 469
            .||..|..||                         .|.|.| |..|         ....|..  .
plant   313 DCIIFISSKE-------------------------FYEDQS-PAVNAAIRLQQRCSEKVGKD--A 349

  Fly   470 NQNAINSSTASLNSTLGTTIGGANSAASLLVNGTGINLSI------------------NLGSPNP 516
            |..||::.....:|.:|..||...:..|.:.:.|..|:.|                  ..|||:.
plant   350 NDLAISTRLLVSSSQIGCLIGKGGAVISEMRSVTRANIRILQKEDVPKIAREDEEMVQITGSPDA 414

  Fly   517 APNLAVATQLLEHIK 531
            |  :...||::..::
plant   415 A--MKALTQVILRLR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 20/69 (29%)
PCBP_like_KH 368..433 CDD:239089 21/64 (33%)
KH-I 696..759 CDD:238053
AT1G14170NP_001117282.1 KH-I 43..118 CDD:412160 12/57 (21%)
KH-I 147..219 CDD:412160 20/73 (27%)
KH-I 274..333 CDD:412160 24/87 (28%)
KH-I 355..427 CDD:412160 14/73 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.