DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and PCBP4

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_024309446.1 Gene:PCBP4 / 57060 HGNCID:8652 Length:481 Species:Homo sapiens


Alignment Length:598 Identity:122/598 - (20%)
Similarity:192/598 - (32%) Gaps:246/598 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 SGNTAAALASAAAAAAAATSGGNGSSITNCNSNNSSSSSNAQQQLQLGNYKTNSCWCYGESVCSG 254
            :|..||...|..|.|.|:....:||.                                     .|
Human     3 AGQVAARTHSQVAVAPASPDRMSGSD-------------------------------------GG 30

  Fly   255 IEVEIENNNNNHIHHGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGT 319
            :|.|.|.:         .|..:::|:.....|:||||.|||:..:::.:.||:.:|:.     ..
Human    31 LEEEPELS---------ITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG-----SC 81

  Fly   320 TERVCLITGSTEAIMVVMEFIMDKIRE-------------KPDLTNKIVDTDSKQTQERDKQVKI 371
            .||:..|||||.|:...:..|..|:.|             :|.:|                 :::
Human    82 PERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVT-----------------LRL 129

  Fly   372 LVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKENNKNACKMILSKI 436
            ::|.|..|.:|||.|..||:|:|..|..                                     
Human   130 VIPASQCGSLIGKAGTKIKEIREVRGEI------------------------------------- 157

  Fly   437 VEDPQSGTCLNVSYADVSGPVANFNPTGSPYATNQNAINSSTASLNSTLGTTIGGANSAASLLVN 501
                                   ::|.|                                   :.
Human   158 -----------------------YHPQG-----------------------------------IR 164

  Fly   502 GTGINLSINLGSPNPAPNLAVATQLLEHIKVAMRGSGYSETVTNEVVAALSVLAKYGVLGMGVGV 566
            |.|..:...||...|           .|::.:..|..:|.......||.:..|            
Human   165 GKGAVVRGVLGLWRP-----------PHLESSEPGQPFSGLWEQPEVAPVLCL------------ 206

  Fly   567 SHTNGAH-STLGNFLGVTTLDQQTAAAASAATASNVFGAVGQVNLEQYAAAVASAAAASRPTQSQ 630
             .|.||. ...|:.|..:|        ..|.|.|.|..|: .:.:.|..|.:         .:|.
Human   207 -QTTGAQVQVAGDLLPNST--------ERAVTVSGVPDAI-ILCVRQICAVI---------LESP 252

  Fly   631 LDAAAVQFDPFRHLGSATAPAATPVSLNNNSFGLTATTGTATTAQLGGLSK---------SPT-- 684
            ...|.:.:.|...||:....|       |..|.:....|..|.|::..|.:         :|:  
Human   253 PKGATIPYHPSLSLGTVLLSA-------NQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVV 310

  Fly   685 ----PGDLSSKDSKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQISKKGIFAPGTRNRIVTIT 745
                ||..:|  |:...||..:||.::|..|..:.||:.:|||:::|..:   |.|...|.||||
Human   311 PGLDPGTQTS--SQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQ---AEGAGERHVTIT 370

  Fly   746 GQPSAIAKAQYLI 758
            |.|.:||.|||||
Human   371 GSPVSIALAQYLI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 20/64 (31%)
PCBP_like_KH 368..433 CDD:239089 12/64 (19%)
KH-I 696..759 CDD:238053 28/63 (44%)
PCBP4XP_024309446.1 PCBP_like_KH 42..103 CDD:239089 20/65 (31%)
PCBP_like_KH 126..245 CDD:239089 38/263 (14%)
KH_1 321..385 CDD:306517 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.