DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and Fubp3

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_006233983.1 Gene:Fubp3 / 362106 RGDID:1307004 Length:575 Species:Rattus norvegicus


Alignment Length:492 Identity:102/492 - (20%)
Similarity:169/492 - (34%) Gaps:159/492 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 VPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEF---IM 341
            ||....|.|||:|||.|:.:|.::|.:::::....   |..||.|::||:.|:|......   |:
  Rat    84 VPDKMVGFIIGRGGEQISRIQAESGCKIQIASESS---GIPERPCVLTGTPESIEQAKRLLGQIV 145

  Fly   342 DKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGAFIKQIKEESG-SYVQISQK 405
            |:.|..|...|   |.|...|.:     ::|:|.|..|::|||||..|||::|.:| ..|.|...
  Rat   146 DRCRNGPGFHN---DIDGNSTIQ-----ELLIPASKVGLVIGKGGETIKQLQERTGVKMVMIQDG 202

  Fly   406 PTDVSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTCLNVSYADVSGPVANFNPTGSPYATN 470
            |.... .::.:.|.||....:.|.:|:|..|.|..|                |:|....|.:.:.
  Rat   203 PLPTG-ADKPLRITGDPFKVQQAREMVLEIIREKDQ----------------ADFRGVRSDFTSR 250

  Fly   471 QNAINSSTASLNSTLGTTIGGANSAASLLVNGTGINLSINLG---SPNPAPNLAVATQLLEHIKV 532
            ....:...:.....:|..||........:.|..|:.:.....   ||..|..:.......:|   
  Rat   251 AGGGSIEVSVPRFVVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERAAQVMGPPDRCQH--- 312

  Fly   533 AMRGSGYSETVTNEVVAALSVLAKYGVLGMGVGVSHTNGAHSTLGNFLGVTTLDQQTAAAASAAT 597
                   :..:.||::....   :..:||   |::.|.|.....|::                  
  Rat   313 -------AARIINELILTAQ---EREILG---GLTGTRGRGRGRGDW------------------ 346

  Fly   598 ASNVFGAVGQVNLEQYAAAVASAAAASRPTQSQLDAAAVQFDPFRHLGSATAPAATPVSLNNNSF 662
                  :||                                                        
  Rat   347 ------SVG-------------------------------------------------------- 349

  Fly   663 GLTATTGTATTAQLGGLSKSPTPGDLSSKDSKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQI 727
                                 |||.:   ......||....|.::|..|.::..|...|||:|::
  Rat   350 ---------------------TPGGI---QEITYTVPADKCGLVIGKGGENIKSINQQSGAHVEL 390

  Fly   728 SKKGIFAPGT--RNRIVTITGQPSAIAKAQYLIEQKI 762
            .:..  .|.|  ..||.||.|.|..|..|::||::|:
  Rat   391 QRNP--PPNTDPNLRIFTIRGAPQQIEVARHLIDEKV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 20/62 (32%)
PCBP_like_KH 368..433 CDD:239089 22/65 (34%)
KH-I 696..759 CDD:238053 21/64 (33%)
Fubp3XP_006233983.1 KH-I 79..141 CDD:238053 20/59 (34%)
KH 161..232 CDD:197652 24/76 (32%)
KH-I 255..317 CDD:238053 9/71 (13%)
KH-I 356..421 CDD:238053 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.