DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and tofu-7

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_498547.1 Gene:tofu-7 / 175988 WormBaseID:WBGene00022737 Length:279 Species:Caenorhabditis elegans


Alignment Length:243 Identity:47/243 - (19%)
Similarity:87/243 - (35%) Gaps:94/243 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EVEIENNNNNHIHHGETTYHMKILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTT 320
            :.:.||..:..:......|.::|  ||.|.||::||.|.|:..|..:|               .|
 Worm    39 DTDSENEADGILADASKDYFIRI--PAFAVGAVVGKRGMTLRRLMYET---------------QT 86

  Fly   321 ERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQE--------------------- 364
            |  |::...|.              |:.|:.:..|..|::.|::                     
 Worm    87 E--CVLRSYTP--------------EELDVASNEVSADAEWTEQFQNEDWFGEESTDTRRKITYL 135

  Fly   365 ----RDKQ-VKIL---------------------VPNSTAGMIIGKGGAFIKQIKEESGSYVQIS 403
                .|:| ||::                     |.....|.::|:||..||.::::....:|||
 Worm   136 LVRATDEQCVKLVRLRIAEIIDNVQKPWKTAEFEVETQMVGYLVGRGGRHIKTLRDKFSVNIQIS 200

  Fly   404 QK-PTD-----VSLQERCITIIGDKENNKNACKMILSKIVEDPQSGTC 445
            .. |.|     |:::.|.:|.:.:.|        ::.|....|::..|
 Worm   201 DPIPDDPTRSLVTVRGRDLTALKEVE--------VVMKETVLPRNYNC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 16/64 (25%)
PCBP_like_KH 368..433 CDD:239089 19/92 (21%)
KH-I 696..759 CDD:238053
tofu-7NP_498547.1 KH 59..>110 CDD:197652 20/83 (24%)
KH_1 165..>216 CDD:278442 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10288
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.