DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ps and IGF2BP1

DIOPT Version :9

Sequence 1:NP_001262415.1 Gene:ps / 44258 FlyBaseID:FBgn0261552 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_006537.3 Gene:IGF2BP1 / 10642 HGNCID:28866 Length:577 Species:Homo sapiens


Alignment Length:662 Identity:121/662 - (18%)
Similarity:202/662 - (30%) Gaps:296/662 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ISHISNISNISNIGNISNSNHSNAAYSLAVHSYQ-------KQIESPA-NPSHVPHHQMDLSPLS 171
            ::....:.|...:...|.:...|..||....:.|       .|:|:.| ..|::|..|:...|  
Human   101 LAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGP-- 163

  Fly   172 ENGSPNGTPGAQTPTATASGNTAAALASAAAAAAAATSGGNGSSITNCNSNNSSSSSNAQQQLQL 236
            |||...|......|..          .|..||.|.|                      .|||:.:
Human   164 ENGRRGGFGSRGQPRQ----------GSPVAAGAPA----------------------KQQQVDI 196

  Fly   237 GNYKTNSCWCYGESVCSGIEVEIENNNNNHIHHGETTYHMKILVPAVASGAIIGKGGETIASLQK 301
                                                  .:::|||....||||||.|.||.::.|
Human   197 --------------------------------------PLRLLVPTQYVGAIIGKEGATIRNITK 223

  Fly   302 DTGARVKMSKSHDFYPGTTERVCLITGSTEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERD 366
            .|.:::.:.:..:  .|..|:...:..:.|......:.|::           |:..::|.|:..|
Human   224 QTQSKIDVHRKEN--AGAAEKAISVHSTPEGCSSACKMILE-----------IMHKEAKDTKTAD 275

  Fly   367 K-QVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSL--QERCITIIGDKENNKNA 428
            : .:|||..|:..|.:|||.|..:|::::::.:.:.||.. .|::|  .||.||:.|..||...|
Human   276 EVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSL-QDLTLYNPERTITVKGAIENCCRA 339

  Fly   429 CKMILSKIVEDPQSGTCLNVSYADVSGPVANFNPTGSPYATNQNAINSSTASLNSTLGTTIGGAN 493
            .:.|:.|:.|..::         ||                       :..||.|.|   |.|.|
Human   340 EQEIMKKVREAYEN---------DV-----------------------AAMSLQSHL---IPGLN 369

  Fly   494 SAASLLVNGTGINLSINLGSPNPAPNLAVATQLLEHIKVAMRGSGYSETVTNEVVAALSVLAKYG 558
            .||                                                              
Human   370 LAA-------------------------------------------------------------- 372

  Fly   559 VLGMGVGVSHTNGAHSTLGNFLGVTTLDQQTAAAASAATASNVFGAVGQVNLEQYAAAVASAAAA 623
                             :|.|                                     .||::|.
Human   373 -----------------VGLF-------------------------------------PASSSAV 383

  Fly   624 SRPTQSQLDAAAVQFDPFRHLGSATAPAATPVSLNNNSFGLTATTGTATTAQLGGLSKSPTPGDL 688
            ..|..|...||     |:                  :||                 .::|     
Human   384 PPPPSSVTGAA-----PY------------------SSF-----------------MQAP----- 403

  Fly   689 SSKDSKNVEVPEVIIGAILGPSGRSLVEIQHVSGANVQISKKGIFAPGTRNRIVTITGQPSAIAK 753
             .::...|.:|...:|||:|..|:.:.::...:.|:::|:...  .|.::.|:|.|||.|.|..|
Human   404 -EQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPE--TPDSKVRMVIITGPPEAQFK 465

  Fly   754 AQYLIEQKINEE 765
            ||..|..|:.||
Human   466 AQGRIYGKLKEE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
psNP_001262415.1 PCBP_like_KH 275..340 CDD:239089 17/64 (27%)
PCBP_like_KH 368..433 CDD:239089 22/66 (33%)
KH-I 696..759 CDD:238053 20/62 (32%)
IGF2BP1NP_006537.3 RRM1_IGF2BP1 1..77 CDD:241069
RRM2_IGF2BP1 81..156 CDD:410037 10/54 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..190 11/63 (17%)
Necessary for interaction with ELAVL4 and binding to TAU mRNA. /evidence=ECO:0000250 187..570 100/564 (18%)
KH-I_IGF2BP1_rpt1 197..272 CDD:411918 20/87 (23%)
KH-I_IGF2BP1_rpt2 273..369 CDD:411921 34/131 (26%)
Sufficient for nuclear export 310..324 4/14 (29%)
KH-I_IGF2BP1_rpt3 404..479 CDD:411924 24/76 (32%)
Sufficient for nuclear export 485..495
KH-I_IGF2BP1_rpt4 487..562 CDD:411927
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.