DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab2 and CG32121

DIOPT Version :9

Sequence 1:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001097599.1 Gene:CG32121 / 317867 FlyBaseID:FBgn0052121 Length:648 Species:Drosophila melanogaster


Alignment Length:416 Identity:119/416 - (28%)
Similarity:176/416 - (42%) Gaps:92/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QQFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYD-NPCQH 259
            |||||||:|:|::|.:....||......|||:|.||..::||::||||||.:|..:|.. ....|
  Fly    28 QQFCLRWHNHQTSLLSTLPILLDQSHLTDVTISAEGRQLRAHRVVLSACSSFFMDIFRALEASNH 92

  Fly   260 PIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEV------SAGRGEGGA 318
            |:||:...|:..:.:|:.|||.||:||.::||..||.:||||.|:|||:|      ...|..||:
  Fly    93 PVIIIPGASFGAIVSLLTFMYSGEVNVYEEQIPMLLNLAETLGIKGLADVQNNNLPKTARSGGGS 157

  Fly   319 SALPMSAFDDEDEEEE---------------------------------------LASATAILQQ 344
            .   |...:::..|.|                                       ||:....:..
  Fly   158 Y---MDTTNEKSSEFERPTTPSPTPTPTLTPSHTPTPSHSLPLPQLPSAALNTPLLANKLGSVNS 219

  Fly   345 DG-DADPDEEM-KAKR--PRLLPEGVLDLNQRQRKRSRD--GSYATPSPSLQGG----ESEISER 399
            .| ...|.|.: |:.:  |.|||: .|:.:|....::.:  ..|.......|.|    :.|....
  Fly   220 SGMGTTPLENLFKSLQFYPSLLPQ-PLNFSQTALNKTTELLAKYQQQCQLYQSGMQEDQLETDCF 283

  Fly   400 GSSGTPGQSQSQPLAMTTSTIVRNP--------FASPNPQTLEGRNSAMNAVANQRKSPAPTATG 456
            ||....|.|..:.|.....::::||        .:|.:||.....|.   .||....:.||....
  Fly   284 GSKRLKGDSPPKELRRLEKSLLKNPKSSSTTNSSSSKSPQECSNPNP---IVATSPVTLAPPTMA 345

  Fly   457 HSNGN------SGAAMHSPPGGVAVQSALPPHMAAIVPP----PPSAMHHHAQQLAAQHQLAHSH 511
            |.:..      |.|:..|..|...:.|:.||..:|.|.|    ..:.||||.|...:.:..|..|
  Fly   346 HFSPQLPVVKCSSASYPSALGQGQLYSSKPPLYSAAVTPTAAQQAAQMHHHPQPGPSPYISAEDH 410

  Fly   512 AM-----------ASALAAAAAGAGA 526
            |.           |:|.||||||..|
  Fly   411 AKLQLHIEQYQREAAAAAAAAAGGMA 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab2NP_523879.2 BTB 213..309 CDD:279045 43/96 (45%)
BTB 224..309 CDD:197585 41/85 (48%)
HTH_psq 645..690 CDD:283007
CG32121NP_001097599.1 BTB 48..142 CDD:279045 43/93 (46%)
BTB 56..149 CDD:197585 42/92 (46%)
C2H2 Zn finger 474..494 CDD:275370
C2H2 Zn finger 501..518 CDD:275370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447059
Domainoid 1 1.000 69 1.000 Domainoid score I9606
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 1 1.000 - - otm40394
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23110
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.