DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab2 and pre-lola-G

DIOPT Version :9

Sequence 1:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster
Sequence 2:NP_001260870.2 Gene:pre-lola-G / 14462577 FlyBaseID:FBgn0264817 Length:436 Species:Drosophila melanogaster


Alignment Length:208 Identity:43/208 - (20%)
Similarity:67/208 - (32%) Gaps:52/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 LQQDGDADPDEEMKAKRPRLLPEGVLDLNQR-QRKRSRDGS-----------------YATPSPS 388
            |.:..:..||....|:..|.....:|:..|| ::|....||                 |.|.|..
  Fly     1 LSRKENTAPDVASTAEIQRSFQRSILNGKQRDEQKIQLPGSRRKRLSVTEVSDMLFEFYKTKSAK 65

  Fly   389 LQGGE----------------SEISERGSSGTPGQSQSQPLAMTTSTIVRNPFASPNPQTLEGRN 437
            :...|                |.||.....||..::.|:.|.......|:|..|:.......|..
  Fly    66 VPKAEQPHRQVSPTSGEILDPSTISAIAVYGTASETASKNLNADEVMRVQNATATRVVGAAAGAA 130

  Fly   438 SAMNAVANQRKSPAPTATGHSN--------GNSGAAMHSPPGGVAVQSALPPHMAAIVPPPPSAM 494
            ::.:.........|.::|.|:.        .||.||:...|....:..||          ..:.:
  Fly   131 ASFHPRPKYTLKTAASSTEHTTAIPTSVLVANSAAALTPKPQAAVIAEAL----------MRNGL 185

  Fly   495 HHHAQQLAAQHQL 507
            |:..|||.||..|
  Fly   186 HNFQQQLRAQEIL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab2NP_523879.2 BTB 213..309 CDD:279045
BTB 224..309 CDD:197585
HTH_psq 645..690 CDD:283007
pre-lola-GNP_001260870.2 C2H2 Zn finger 338..358 CDD:275368
zf-H2C2_5 366..389 CDD:290620
C2H2 Zn finger 368..388 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.