DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab2 and btbd18

DIOPT Version :9

Sequence 1:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_017951392.1 Gene:btbd18 / 100498010 -ID:- Length:602 Species:Xenopus tropicalis


Alignment Length:267 Identity:66/267 - (24%)
Similarity:105/267 - (39%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 WNNYQSNLTNVFDELLQSES---FVDVTL-SCEGHSIKAHKMVLSACSPYFQALF---------- 252
            ||  ...|..:|.:|.:.::   |.|||| ..||..:..|..:|:|||||...|.          
 Frog    10 WN--PRLLRTMFLQLQRQQNTGFFCDVTLQGGEGEGVSVHACLLAACSPYLAKLLASVTEVSQLD 72

  Fly   253 ----YDNPCQHPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLAEVSAGR 313
                ....|...|:.:..:....|..||.:||..|:.|..:.::.:|:.|..|:|   .|:...|
 Frog    73 TDSAIQTDCTGHILTVPGIPSCYLLPLVHYMYTSELEVTPENVHGVLEAARRLQI---PELEGLR 134

  Fly   314 GEGGASALPMSAFDDEDEEEELAS-------ATAILQ---QDGDAD---PDEEMKAKR---PRLL 362
            .|||....|           |||.       .:.|.|   :.|:..   ..||:.:.|   .|:.
 Frog   135 LEGGRLVRP-----------ELARKLNRDCFGSVISQYATESGNGKQIFTKEEITSGRNVPVRMH 188

  Fly   363 PEGVLDLNQRQRKRSRDGSYATPSPSLQGGESEISERGSSGTPGQSQSQPLAMTTSTIVRNPFAS 427
            .:|...|.:|..|   :.::...:.||..|:.|    .||...|..::..|.:|     :||...
 Frog   189 EQGPCILEKRTNK---EHTFPADTGSLLRGKME----ASSSLQGNIENPLLEIT-----KNPTEK 241

  Fly   428 PNPQTLE 434
            ..|.|::
 Frog   242 SGPSTVQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab2NP_523879.2 BTB 213..309 CDD:279045 30/113 (27%)
BTB 224..309 CDD:197585 27/99 (27%)
HTH_psq 645..690 CDD:283007
btbd18XP_017951392.1 BTB_POZ_BTBD18 17..148 CDD:349602 39/144 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.