DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bab2 and Btbd18

DIOPT Version :9

Sequence 1:NP_523879.2 Gene:bab2 / 44254 FlyBaseID:FBgn0025525 Length:1067 Species:Drosophila melanogaster
Sequence 2:XP_002729248.1 Gene:Btbd18 / 100363270 RGDID:2323370 Length:724 Species:Rattus norvegicus


Alignment Length:323 Identity:77/323 - (23%)
Similarity:115/323 - (35%) Gaps:76/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 QSESFVDVTLSCEGHSIKAHKMVLSACSPYF-QALFYDNPCQHPIIIMR--DVSWSDLKALVEFM 279
            ||..|.|..|..||.::.||..:||||||:| :.|..:.|.|...:::.  .:....|:.||:|:
  Rat    29 QSGVFCDALLQAEGEAVPAHCCILSACSPFFTERLERERPVQGRKVVLELGGLKIQTLRKLVDFL 93

  Fly   280 YKGEINVCQDQINPLLKVA--------ETLKIRG--LAEVSAGRGEGGASALPMSAFDDEDEEEE 334
            |..|:.|.|::...:|..|        |||::.|  |.:...||........|.||..       
  Rat    94 YTSEMEVSQEEAQDVLSAARQLRVSELETLQLEGGKLVKAPQGRRLNRECLQPPSAAP------- 151

  Fly   335 LASATAILQQDGDADP------------------DEEMKAKRPRLLPEG-----VLDLNQRQRKR 376
             .||..::.:.....|                  .||..|.:...||..     .|.|.::.|..
  Rat   152 -ISARVVVPRSRPRTPLPVTQTPSPLGAVKLKSLGEEEGAHKKSNLPNADNLSDTLLLKKKARVC 215

  Fly   377 SRDGSYATPSPSLQGGESEISERGSSGTPG-----QSQSQPLAMTTSTIVRNPFASPNPQTLEGR 436
            ......::||...:|.:...|..||:..|.     ..|..|..:..|.      :.|:|.....:
  Rat   216 LTQERSSSPSSQREGPKENKSNPGSTALPSLYPSVDEQLLPRKIRLSR------SKPSPHVYTSK 274

  Fly   437 NSAMNAVANQRKSPAPTATGH--------SNGNSGAAMHSPPGGVAVQSALPPHMAAIVPPPP 491
            .|:|.:    ..|..|||.|.        |....|.....|.....:||         .|.||
  Rat   275 PSSMLS----GPSSMPTAPGRRLWRQRTVSEATQGVDKQKPGEVSTLQS---------TPDPP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bab2NP_523879.2 BTB 213..309 CDD:279045 34/103 (33%)
BTB 224..309 CDD:197585 31/97 (32%)
HTH_psq 645..690 CDD:283007
Btbd18XP_002729248.1 BTB 24..123 CDD:279045 30/93 (32%)
BTB 35..123 CDD:197585 27/87 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.