DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL8 and mrpl2

DIOPT Version :9

Sequence 1:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001314714.1 Gene:mrpl2 / 571648 ZFINID:ZDB-GENE-050809-12 Length:294 Species:Danio rerio


Alignment Length:221 Identity:59/221 - (26%)
Similarity:91/221 - (41%) Gaps:41/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVY-C- 90
            :|||....|:...:..|: ::.:||.|.|.:|:|...:      ||...||.:.|..|..:. | 
Zfish    99 RLRSEPGKEQPVMVEKVL-EVRYDPCRSADIALVAGGN------RKRWIIASQNMEAGDLIQSCR 156

  Fly    91 --GRKATL-QIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPS 152
              ||.|.| |.|:..|:..:|.||:|.|||...|...:..|.:|....::.....|  ..::|||
Zfish   157 GIGRMAVLAQEGDAHPVGALPVGTLIHNLELFPGRGAQYIRAAGTCGVLLRKVSGT--AIIQLPS 219

  Fly   153 GAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQ 217
            ..:..|.....|.||.|:......:.|.|||         .|.|..:|         |..|    
Zfish   220 KHQIQVLETCVATVGRVSNVDHNKRIIGKAG---------TNRWLGIR---------PSSG---- 262

  Fly   218 HIGKASTVKRGTSAGRKVGLIAARRT 243
                 ...::|..||||:..:.|.::
Zfish   263 -----RWQRKGGWAGRKIRPLPAMKS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 59/221 (27%)
mrpl2NP_001314714.1 Ribosomal_L2_C 53..>260 CDD:332035 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.