DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL8 and MRPL2

DIOPT Version :9

Sequence 1:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_057034.2 Gene:MRPL2 / 51069 HGNCID:14056 Length:305 Species:Homo sapiens


Alignment Length:245 Identity:67/245 - (27%)
Similarity:95/245 - (38%) Gaps:58/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAE------RSGYIRGVVKDIIHDPGRGAPLAV 60
            || ||....|.|.      |:|     .|.:||..      :||.....|..:.:||.|.|.:|:
Human    89 GR-IRVHGIGGGH------KQR-----YRMIDFLRFRPEETKSGPFEEKVIQVRYDPCRSADIAL 141

  Fly    61 VHFRDPYRYKIRKELFIAPEGMHTGQFV----YCGRKA-TLQIGNVMPLSQMPEGTIICNLEEKT 120
            |....      ||...||.|.|..|..:    :.||.| ..:.|:..||..:|.||:|.|:|.:.
Human   142 VAGGS------RKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEP 200

  Fly   121 GDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRA 185
            |...:..|.:|....::.....|  ..::|||..:..|.....|.||.|:......:.|.|||  
Human   201 GRGAQYIRAAGTCGVLLRKVNGT--AIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKAG-- 261

  Fly   186 YHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKV 235
                   ||.|...|         |:.|..|         ::|..||||:
Human   262 -------RNRWLGKR---------PNSGRWH---------RKGGWAGRKI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 67/245 (27%)
MRPL2NP_057034.2 RplB 67..>270 CDD:424298 59/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.720

Return to query results.
Submit another query.