DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL8 and rpl8

DIOPT Version :9

Sequence 1:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_988925.1 Gene:rpl8 / 394521 XenbaseID:XB-GENE-482209 Length:257 Species:Xenopus tropicalis


Alignment Length:250 Identity:202/250 - (80%)
Similarity:225/250 - (90%) Gaps:0/250 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRD 65
            ||||||.||||||||||||||.||||||||::|||||.|||:|:|||||||||||||||.|.|||
 Frog     1 MGRVIRGQRKGAGSVFKAHVKHRKGAAKLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVAFRD 65

  Fly    66 PYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTS 130
            |||:|.|.|||:|.||:|||||||||:||.|.||||:|:..||||||:|.:|||.||||:|||.|
 Frog    66 PYRFKKRTELFVAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCVEEKPGDRGKLARAS 130

  Fly   131 GNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNS 195
            |||||||:||.:|||||||||||:|||:.|||||:||:||||||||||||||||||||||.|||.
 Frog   131 GNYATVISHNPETKKTRVKLPSGSKKVISSANRAIVGVVAGGGRIDKPILKAGRAYHKYKAKRNC 195

  Fly   196 WPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK 250
            ||:||||||||||||.||||||||||.||::|...|||||||||||||||:||.|
 Frog   196 WPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 201/249 (81%)
rpl8NP_988925.1 PTZ00180 1..254 CDD:173464 201/249 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..231 17/23 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2483
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32141
Inparanoid 1 1.050 423 1.000 Inparanoid score I1739
OMA 1 1.010 - - QHG62185
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 1 1.000 - - FOG0002056
OrthoInspector 1 1.000 - - oto104612
Panther 1 1.100 - - LDO PTHR13691
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1126
SonicParanoid 1 1.000 - - X1357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.