DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL8 and Rpl8

DIOPT Version :9

Sequence 1:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_001030088.2 Gene:Rpl8 / 26962 RGDID:619827 Length:257 Species:Rattus norvegicus


Alignment Length:250 Identity:202/250 - (80%)
Similarity:225/250 - (90%) Gaps:0/250 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRD 65
            ||||||.|||||||||:||||.|||||:||::|||||.|||:|:|||||||||||||||.|.|||
  Rat     1 MGRVIRGQRKGAGSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDIIHDPGRGAPLAKVVFRD 65

  Fly    66 PYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTS 130
            |||:|.|.|||||.||:|||||||||:||.|.||||:|:..||||||:|.||||.||||:|||.|
  Rat    66 PYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARAS 130

  Fly   131 GNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNS 195
            |||||||:||.:|||||||||||:|||:.|||||:||:||||||||||||||||||||||.|||.
  Rat   131 GNYATVISHNPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGRIDKPILKAGRAYHKYKAKRNC 195

  Fly   196 WPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAARRTGRIRGGK 250
            ||:||||||||||||.||||||||||.||::|...|||||||||||||||:||.|
  Rat   196 WPRVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAARRTGRLRGTK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 201/249 (81%)
Rpl8NP_001030088.2 RplB 1..254 CDD:424298 201/249 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..232 17/24 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345787
Domainoid 1 1.000 226 1.000 Domainoid score I2432
eggNOG 1 0.900 - - E1_COG0090
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 423 1.000 Inparanoid score I1716
OMA 1 1.010 - - QHG62185
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 1 1.000 - - FOG0002056
OrthoInspector 1 1.000 - - otm45921
orthoMCL 1 0.900 - - OOG6_100234
Panther 1 1.100 - - LDO PTHR13691
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1357
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.