DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL8 and mrpl-2

DIOPT Version :9

Sequence 1:NP_524726.1 Gene:RpL8 / 44251 FlyBaseID:FBgn0261602 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_499987.2 Gene:mrpl-2 / 176903 WormBaseID:WBGene00018932 Length:321 Species:Caenorhabditis elegans


Alignment Length:175 Identity:42/175 - (24%)
Similarity:72/175 - (41%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDFAERSGYIRGVVKD-----IIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFV--- 88
            :||..|....:|...|     |..||.|...:|:....:..|:      .:|.|.|..|..:   
 Worm    89 IDFHRRGPADQGATYDERILEIRRDPNRTCHIALCAGINGKRW------ILATENMKAGDVISTS 147

  Fly    89 -YCGRKATLQI-GNVMPLSQMPEGTIICNLEE-KTGDRGRLARTSGNYATVIAHNQDTKKTRVKL 150
             :......:.: ||..|:..:..||:|.::|. .|.|.....:.:|..||::.|..|.  |.|||
 Worm   148 GHLSENPVIGVEGNAYPIGSLAAGTVINSIERYPTMDSETFVKAAGTSATIVRHQGDF--TVVKL 210

  Fly   151 PSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNS 195
            |...:..:.....|.||.::... ||..|..:.:.:.::..|.:|
 Worm   211 PHKHEFSLHRTCMATVGRLSHAD-IDGKIFGSAQMHRRFGYKMSS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL8NP_524726.1 PTZ00180 1..256 CDD:173464 42/175 (24%)
mrpl-2NP_499987.2 RplB 22..>246 CDD:223168 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1156335at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100234
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.